| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
7, 9 kD |
| UniProt number: |
P10889 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CXCL2, MIP-2, C-X-C Motif Chemokine 2 |
| Short name: |
CXCL2, MIP-2, Recombinant Mouse C-X-C Motif Chemokine 2 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
MIP-2, chemokine (C-X-C motif) ligand 2, recombinant Mouse C-X-C Motif Chemokine 2 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CINC-2a and GRO2 and GROb and MGSA-b and MIP-2a and MIP2 and MIP2A and SCYB2, CXCL2 and IDBG-24257 and ENSG00000081041 and 2920, Extracellular, chemokine activity, this GO :0002237 and response to molecule of bacterial origin and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008009 and chemokine activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 2 |
| Identity: |
4603 |
| Gene: |
CXCL2 |
More about : CXCL2 |
| Long gene name: |
C-X-C motif chemokine ligand 2 |
| Synonyms gene: |
GRO2 |
| Synonyms gene name: |
GRO2 oncogene chemokine (C-X-C motif) ligand 2 |
| Synonyms: |
SCYB2 GROb MIP-2a MGSA-b CINC-2a |
| Locus: |
4q13, 3 |
| Discovery year: |
1991-05-21 |
| GenBank acession: |
M36820 |
| Entrez gene record: |
2920 |
| Pubmed identfication: |
2217207 |
| RefSeq identity: |
NM_002089 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160865 |