| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Mouse Death Receptor 6 is produced by our Mammalian expression system and the target gene encoding Gln42-His349 is expressed with a Fc |
| Molecular Weight: |
64, 7 kD |
| UniProt number: |
Q9EPU5 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QPEQKTLSLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTHQQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD358 (C-Fc-6His), DR6, TNFRSF21, Death Receptor 6 |
| Short name: |
CD358 (C-Fc-6His), DR6, TNFRSF21, Recombinant Mouse Death Receptor 6 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD358 (C-fragment c-6His), DR6, member 21, tumor necrosis factor receptor superfamily, recombinant Mouse Death Receptor 6 |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, TNFRSF21 and IDBG-632394 and ENSBTAG00000020054 and 537922, TNFRSF21 and IDBG-90063 and ENSG00000146072 and 27242, Tnfrsf21 and IDBG-184035 and ENSMUSG00000023915 and 94185, member 21, protein binding, this GO :0001783 and B cell apoptotic process and biological process this GO :0002250 and adaptive immune response and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0030424 and axon and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031226 and intrinsic component of plasma membrane and cellular component this GO :0031642 and negative regulation of myelination and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042552 and myelination and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0048713 and regulation of oli this GO dendrocyte differentiation and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0097252 and oli this GO dendrocyte apoptotic process and biological process this GO :2000663 and negative regulation of interleukin-5 secretion and biological process this GO :2000666 and negative regulation of interleukin-13 secretion and biological process this GO :2001180 and negative regulation of interleukin-10 secretion and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily |
| Identity: |
13469 |
| Gene: |
TNFRSF21 |
More about : TNFRSF21 |
| Long gene name: |
TNF receptor superfamily member 21 |
| Synonyms gene name: |
member 21 , tumor necrosis factor receptor superfamily |
| Synonyms: |
DR6 CD358 |
| Synonyms name: |
death receptor 6 |
| Locus: |
6p12, 3 |
| Discovery year: |
2001-07-27 |
| GenBank acession: |
AF068868 |
| Entrez gene record: |
27242 |
| Pubmed identfication: |
9714541 |
| RefSeq identity: |
NM_014452 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000014796 |