Recombinant Mouse Death Receptor 6, DR6, TNFRSF21, CD358 (C-Fc-6His)

Contact us
Catalog number: CD79
Price: 406 €
Supplier: NJS poly
Product name: Recombinant Mouse Death Receptor 6, DR6, TNFRSF21, CD358 (C-Fc-6His)
Quantity: 0.4 ml
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Mouse Death Receptor 6 is produced by our Mammalian expression system and the target gene encoding Gln42-His349 is expressed with a Fc
Molecular Weight: 64, 7 kD
UniProt number: Q9EPU5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QPEQKTLSLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLFFSSTNPPSSGTVTFSHPEHMESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSGIEEGTVPDNTSSTSGKEGTNRTLPNPPQVTHQQAPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNAHKHFDINEHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD358 (C-Fc-6His), DR6, TNFRSF21, Death Receptor 6
Short name: CD358 (C-Fc-6His), DR6, TNFRSF21, Recombinant Mouse Death Receptor 6
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD358 (C-fragment c-6His), DR6, member 21, tumor necrosis factor receptor superfamily, recombinant Mouse Death Receptor 6
Alternative technique: rec
Alternative to gene target: Plasma membranes, TNFRSF21 and IDBG-632394 and ENSBTAG00000020054 and 537922, TNFRSF21 and IDBG-90063 and ENSG00000146072 and 27242, Tnfrsf21 and IDBG-184035 and ENSMUSG00000023915 and 94185, member 21, protein binding, this GO :0001783 and B cell apoptotic process and biological process this GO :0002250 and adaptive immune response and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0030424 and axon and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031226 and intrinsic component of plasma membrane and cellular component this GO :0031642 and negative regulation of myelination and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042552 and myelination and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0048713 and regulation of oli this GO dendrocyte differentiation and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0097252 and oli this GO dendrocyte apoptotic process and biological process this GO :2000663 and negative regulation of interleukin-5 secretion and biological process this GO :2000666 and negative regulation of interleukin-13 secretion and biological process this GO :2001180 and negative regulation of interleukin-10 secretion and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily
Identity: 13469
Gene: TNFRSF21 | More about : TNFRSF21
Long gene name: TNF receptor superfamily member 21
Synonyms gene name: member 21 , tumor necrosis factor receptor superfamily
Synonyms: DR6 CD358
Synonyms name: death receptor 6
Locus: 6p12, 3
Discovery year: 2001-07-27
GenBank acession: AF068868
Entrez gene record: 27242
Pubmed identfication: 9714541
RefSeq identity: NM_014452
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000014796

Related Products :

CD79 Recombinant Mouse Death Receptor 6, DR6, TNFRSF21, CD358 (C-Fc-6His) 1 mg 2283 € novo mouse
C327 Recombinant Human Death Receptor 6, DR6, TNFRSF21, CD358 (C-6His) 10 µg 90 € novo human
CG09 Recombinant Human Death Receptor 6, DR6, TNFRSF21, CD358 (C-Fc) 50 µg 232 € novo human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
AM20114PU-N anti-TNFRSF21 / Death receptor 6 (DR6) (42-335) Antibody 0,1 mg 790 € acr human
SM3132F anti-TNFRSF21 / Death receptor 6 (DR6) (42-335) Antibody 0,1 mg 529 € acr human
SP1298 anti-TNFRSF21 / Death receptor 6 (DR6) (42-56) Antibody 0,1 mg 514 € acr human
SM3132P anti-TNFRSF21 / Death receptor 6 (DR6) Antibody 0,1 mg 427 € acr human
SM3132PX anti-TNFRSF21 / Death receptor 6 (DR6) Antibody 0,2 mg 543 € acr human
SM3132RP anti-TNFRSF21 / Death receptor 6 (DR6) Antibody 0,1 mg 616 € acr human
AP30301CP-N anti-TNFRSF21 / Death receptor 6 (DR6) Control Peptide Antibody 50 Вµg 282 € acr human
RP-1245M Recombinant Mouse DR6 / TNFRSF21 Protein (His Tag) 50μg 624 € adv mouse
RP-0576H Recombinant Human DR6 / TNFRSF21 Protein 100μg 624 € adv human
RP-0577H Recombinant Human DR6 / TNFRSF21 Protein (Fc Tag) 100μg 659 € adv human
RP-0575H Recombinant Human DR6 / TNFRSF21 Protein (His Tag) 100μg 659 € adv human
ACLX207AP DR6/TNFRSF21, Mouse Monoclonal antibody-; Clone: DR-6-04-EC 0.1 mg 353 € accurate-monoclonals mouse
ACLX207DY647 DR6/TNFRSF21, Mouse Monoclonal antibody-; Clone: DR-6-04-EC, DY647 conj. 0.1 mg Ask price € accurate-monoclonals mouse
ACLX207PE DR6/TNFRSF21, Mouse Monoclonal antibody-; Clone: DR-6-04-EC, PE conj. 0.1 mg 553 € accurate-monoclonals mouse
GENTAUR-58b8ea326d804 Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b8ea32d7785 Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b8ea335b63b Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 100ug 2746 € MBS Recombinant Proteins human
GENTAUR-58b8ea33c2f6c Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 1000ug 2746 € MBS Recombinant Proteins human
GENTAUR-58b9e65e86408 Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9e65eed321 Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9e65f4e0f0 Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 100ug 2746 € MBS Recombinant Proteins human
GENTAUR-58b9e65f7fd9c Saccharomyces cerevisiae Transposon Ty1-DR6 Gag polyprotein (TY1A-DR6) 1000ug 2746 € MBS Recombinant Proteins human
MBS619939 Tumor Necrosis Factor Receptor 1-Associated Death Domain Protein Isoform 2 (TRADD, TNFR1-associated DEATH domain protein, TNFRSF1A-associated via death domain, Tumor necrosis factor receptor type 1-associated DEATH domain protein) Antibody 100ug 763 € MBS Polyclonals_1 human
YSRTMCA2333 Death Receptor 6 (DR6), Clone: DR-6-04-EC, Mouse Monoclonal antibody-Human; flow/IP/No WB 200ug 489 € accurate-monoclonals human
F45509-0.08ML DR6 Antibody (Death Receptor 6) 0.08 ml 199 € NJS poly human
F45509-0.4ML DR6 Antibody (Death Receptor 6) 0.4 ml 406 € NJS poly human