Recombinant Mouse Leukemia Inhibitory Factor, lIF

Contact us
Catalog number: C690
Price: 2078 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Leukemia Inhibitory Factor, lIF
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Leukemia Inhibitory Factor is produced by our E, coli expression system and the target gene encoding Ser24-Phe203 is expressed
Molecular Weight: 19, 9 kD
UniProt number: P09056
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: lIF, Leukemia Inhibitory Factor
Short name: lIF, Recombinant Mouse Leukemia Inhibitory Factor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: leukemia inhibitory factor, recombinant Mouse Leukemia Inhibitory Factor
Alternative technique: rec

Related Products :

MBS623127 Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) Antibody 100ug 564 € MBS Polyclonals_1 human
C690 Recombinant Mouse Leukemia Inhibitory Factor, lIF 500 µg 1613 € novo mouse
C017 Recombinant Human Leukemia Inhibitory Factor, LIF 50 µg 369 € novo human
abx574566 Anti-Mouse Leukemia Inhibitory Factor (LIF) ELISA Kit 96 tests 746 € abbex mouse
DL-LIF-Mu Mouse Leukemia Inhibitory Factor LIF ELISA Kit 96T 869 € DL elisas mouse
abx575572 Anti-Cow Leukemia Inhibitory Factor (LIF) ELISA Kit inquire 50 € abbex cow
abx575573 Anti-Dog Leukemia Inhibitory Factor (LIF) ELISA Kit 96 tests 804 € abbex dog
abx575574 Anti-Goat Leukemia Inhibitory Factor (LIF) ELISA Kit 96 tests 847 € abbex human
abx576321 Anti-Human Leukemia Inhibitory Factor (LIF) ELISA Kit 96 tests 543 € abbex human
GENTAUR-58bdc7ca35d2d Anti- Leukemia Inhibitory Factor (LIF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc7ca7acd5 Anti- Leukemia Inhibitory Factor (LIF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd35102342 Anti- Leukemia Inhibitory Factor (LIF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bddbcc4aeb1 Anti- Leukemia Inhibitory Factor (LIF) Antibody 100ug 531 € MBS Polyclonals human
abx570520 Anti-Pig Leukemia Inhibitory Factor (LIF) ELISA Kit inquire 50 € abbex pig
abx574668 Anti-Rat Leukemia Inhibitory Factor (LIF) ELISA Kit inquire 50 € abbex rat
DL-LIF-b Bovine Leukemia Inhibitory Factor LIF ELISA Kit 96T 962 € DL elisas bovine
DL-LIF-c Canine Leukemia Inhibitory Factor LIF ELISA Kit 96T 921 € DL elisas human
DL-LIF-g Goat Leukemia Inhibitory Factor LIF ELISA Kit 96T 974 € DL elisas human
DL-LIF-Hu Human Leukemia Inhibitory Factor LIF ELISA Kit 96T 672 € DL elisas human
EKU05615 Leukemia Inhibitory Factor (LIF) ELISA kit 1 plate of 96 wells 542 € Biomatik ELISA kits human
EKU05616 Leukemia Inhibitory Factor (LIF) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human
EKU08412 Leukemia Inhibitory Factor (LIF) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GENTAUR-58b8bafa1740a Mustela vison Leukemia inhibitory factor (LIF) 100ug 1575 € MBS Recombinant Proteins human
GENTAUR-58b8bafa6fe80 Mustela vison Leukemia inhibitory factor (LIF) 1000ug 1575 € MBS Recombinant Proteins human
GENTAUR-58b8bafae711f Mustela vison Leukemia inhibitory factor (LIF) 100ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b8bafb4d076 Mustela vison Leukemia inhibitory factor (LIF) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b9bafd6bb5a Mustela vison Leukemia inhibitory factor (LIF) 100ug 1575 € MBS Recombinant Proteins human
GENTAUR-58b9bafdddb52 Mustela vison Leukemia inhibitory factor (LIF) 1000ug 1575 € MBS Recombinant Proteins human
GENTAUR-58b9bafe415df Mustela vison Leukemia inhibitory factor (LIF) 100ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b9bafea499b Mustela vison Leukemia inhibitory factor (LIF) 1000ug 2078 € MBS Recombinant Proteins human