Recombinant Mouse Cystatin 8, CST8 (N-6His)

Contact us
Catalog number: CR02
Price: 528 €
Supplier: abbex
Product name: Recombinant Mouse Cystatin 8, CST8 (N-6His)
Quantity: 15 nmol
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cystatin-8 is produced by our expression system and the target gene encoding Met1-Phe98 is expressed with a 6His tag at the N-terminus
Molecular Weight: 13, 3 kD
UniProt number: P32766
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMMMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CST8 (N-6His), Cystatin 8
Short name: CST8 (N-6His), Recombinant Mouse Cystatin 8
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CST8 (N-6His), recombinant Mouse Cystatin 8
Alternative technique: rec
Identity: 2480
Gene: CST8 | More about : CST8
Long gene name: cystatin 8
Synonyms gene name: cystatin 8 (cystatin-related epididymal specific)
Synonyms: CRES CTES5
Locus: 20p11, 21
Discovery year: 1999-05-18
GenBank acession: AF059244
Entrez gene record: 10047
Pubmed identfication: 7619504 20565543
Classification: Cystatins, type 2
Havana BLAST/BLAT: OTTHUMG00000032071

Related Products :

CR02 Recombinant Mouse Cystatin 8, CST8 (N-6His) 50 µg 496 € novo mouse
GENTAUR-58bb5f13d7265 Human Cystatin-8 (CST8) 100ug 1420 € MBS Recombinant Proteins human
GENTAUR-58bb5f1430724 Human Cystatin-8 (CST8) 1000ug 1420 € MBS Recombinant Proteins human
GENTAUR-58bb5f147982e Human Cystatin-8 (CST8) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bb5f14b96df Human Cystatin-8 (CST8) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58ba03f578872 Rat Cystatin-8 (Cst8) 100ug 1426 € MBS Recombinant Proteins rat
GENTAUR-58ba03f631974 Rat Cystatin-8 (Cst8) 1000ug 1426 € MBS Recombinant Proteins rat
GENTAUR-58ba03f6d5489 Rat Cystatin-8 (Cst8) 100ug 1929 € MBS Recombinant Proteins rat
GENTAUR-58ba03f781725 Rat Cystatin-8 (Cst8) 1000ug 1929 € MBS Recombinant Proteins rat
CD44 Recombinant Mouse Cystatin E, CST6 (C-6His) 10 µg 202 € novo mouse
CD20 Recombinant Mouse Cystatin F, CST7 (C-6His) 500 µg 1613 € novo mouse
C087 Recombinant Human Cystatin A (N-6His) 500 µg 1613 € novo human
CI55 Recombinant Human Cystatin C, CST3 (C-6His) 50 µg 496 € novo human
CE75 Recombinant Human Cystatin C, CST3 (N-6His) 1 mg 2283 € novo human
C397 Recombinant Human Cystatin D, CSTD, CST5 (C-6His) 10 µg 202 € novo human
C334 Recombinant Human Cystatin F, CST7 (C-6His) 50 µg 496 € novo human
C333 Recombinant Human Cystatin M, CST6 (C-6His) 10 µg 202 € novo human
C335 Recombinant Human Cystatin S, CST4 (C-6His) 500 µg 1613 € novo human
C336 Recombinant Human Cystatin SA, CST2 (C-6His) 10 µg 202 € novo human
C462 Recombinant Human Cystatin SN, CST1 (C-6His) 1 mg 2283 € novo human
GENTAUR-58bdfc7d94947 Anti- CST8 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfc7e0bc26 Anti- CST8 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be015f139ee Anti- CST8 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be015f6c91b Anti- CST8 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be07674e9af Anti- CST8 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be07679dee5 Anti- CST8 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be432c79248 Anti- CST8 Antibody 100ug 393 € MBS Polyclonals human
abx146796 Anti-CST8 Antibody 200 μg 369 € abbex human
abx146797 Anti-CST8 Antibody 200 μg 369 € abbex human
abx901309 Anti-CST8 siRNA 15 nmol 528 € abbex human