Recombinant Human Fibroblast Growth Factor Receptor 3, FGFR3 (C-6His)

Contact us
Catalog number: CS68
Price: 369 €
Supplier: novo
Product name: Recombinant Human Fibroblast Growth Factor Receptor 3, FGFR3 (C-6His)
Quantity: 50 µg
Other quantities: 10 µg 141€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Fibroblast Growth Factor Receptor 3 is produced by our Mammalian expression system and the target gene encoding Glu23-Gly375 is expressed with a 6His tag at the C-terminus
Molecular Weight: 39 kD
UniProt number: P22607
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FGFR3 (C-6His), Fibroblast Growth Factor Receptor 3
Short name: FGFR3 (C-6His), Recombinant Fibroblast Growth Factor Receptor 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: FGFR3 (C-6His), sapiens Fibroblast Growth Factor Receptor 3, recombinant H
Alternative technique: rec
Identity: 3690
Gene: FGFR3 | More about : FGFR3
Long gene name: fibroblast growth factor receptor 3
Synonyms gene: ACH
Synonyms gene name: achondroplasia, thanatophoric dwarfism
Synonyms: CEK2 JTK4 CD333
Locus: 4p16, 3
Discovery year: 1991-06-07
GenBank acession: M64347
Entrez gene record: 2261
Pubmed identfication: 1847508
RefSeq identity: NM_000142
Classification: I-set domain containing CD molecules Receptor Tyrosine Kinases
Havana BLAST/BLAT: OTTHUMG00000121148
Locus Specific Databases: LRG_1021

Related Products :

CS68 Recombinant Human Fibroblast Growth Factor Receptor 3, FGFR3 (C-6His) 10 µg 141 € novo human
MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
GWB-12D2C2 Fibroblast Growth Factor Receptor 3 (FGFR3) Rabbit antibody to or anti-Human Polyclonal (aa359-372) antibody 1 x 1 vial 602 € genways human
GWB-6C0B9F Fibroblast Growth Factor Receptor 3 (FGFR3) Rabbit antibody to or anti-Human Polyclonal (aa359-372) antibody 1 tube 648 € genways human
DL-FGFR3-Hu Human Fibroblast Growth Factor Receptor 3 FGFR3 ELISA Kit 96T 788 € DL elisas human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
GENTAUR-58bdd8637b2b6 Anti- Fibroblast Growth Factor Receptor 3 (FGFR3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd863e7c4f Anti- Fibroblast Growth Factor Receptor 3 (FGFR3) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd95197542 Anti- Fibroblast Growth Factor Receptor 3 (FGFR3) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddbff8b8d2 Anti- Fibroblast Growth Factor Receptor 3 (FGFR3) Antibody 100ug 542 € MBS Polyclonals human
E-EL-Ch0440 Chicken FGFR3 (Fibroblast Growth Factor Receptor 3) ELISA Kit 96T 568 € elabsciences chicken
F44217-0.08ML Fibroblast Growth Factor Receptor 3 Antibody (FGFR3) 0.08 ml 199 € NJS poly human
F50621-0.08ML Fibroblast Growth Factor Receptor 3 Antibody (FGFR3) 0.08 ml 199 € NJS poly human
F52700-0.08ML Fibroblast Growth Factor Receptor 3 Antibody (FGFR3) 0.08 ml 199 € NJS poly human
EKU04192 Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU04193 Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-FGFR3-Mu Mouse Fibroblast Growth Factor Receptor 3 FGFR3 ELISA Kit 96T 788 € DL elisas mouse
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human
C996 Recombinant Human Fibroblast Growth Factor 17, FGF-17 (C-6His) 1 mg 2283 € novo human
CG74 Recombinant Human Fibroblast Growth Factor 19, FGF-19 (N-6His) 1 mg 2283 € novo human
C223 Recombinant Human Fibroblast Growth Factor 21, FGF-21 (N-6His) 500 µg 1613 € novo human
CA19 Recombinant Human Fibroblast Growth Factor 23, FGF-23 (C-6His) 10 µg 202 € novo human
CM88 Recombinant Human Fibroblast Growth Factor 7, FGF-7, KGF (C-6His) 10 µg 202 € novo human
CK13 Recombinant Human Fibroblast Growth Factor 8, FGF-8a (N-6His) 10 µg 141 € novo human
CK14 Recombinant Human Fibroblast Growth Factor 8, FGF-8e (N-6His) 50 µg 369 € novo human
CK12 Recombinant Human Fibroblast Growth Factor 8, FGF-8F (N-6His) 10 µg 156 € novo human
CS24 Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His) 50 µg 369 € novo human