Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His)

Contact us
Catalog number: CS63
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His)
Quantity: 0.02 mg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Cynomolgus Monkey
Source: proteins, Recombinants or rec
Description: Recombinant Cynomolgus T-cell Surface Glycoprotein CD3 Delta Chain protein is produced by our Mammalian expression system and the target gene encoding Phe22-Ala105 is expressed with a 6His tag at the C-terminus
Molecular Weight: 10, 4 kD
UniProt number: Q95LI8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: Cynomolgus CD3d CD3 delta Protein (C-6His)
Short name: Recombinant Cynomolgus CD3d CD3 delta Protein (C-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: CD3 delta Protein (C-6His), delta (CD3-TCR complex) , recombinant Cynomolgus CD3d molecule
Alternative technique: rec

Related Products :

CS63 Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His) 1 mg 2283 € novo human
RP-1044RC Recombinant Cynomolgus CD3d / CD3 delta Protein (Fc Tag) 20μg 572 € adv human
RP-1045RC Recombinant Cynomolgus CD3d / CD3 delta Protein (His Tag) 20μg 572 € adv human
RP-0327H Recombinant Human CD3d / CD3 delta Protein (Fc & FLAG Tag) 20μg 572 € adv human
RP-0328H Recombinant Human CD3d / CD3 delta Protein (His Tag) 20μg 572 € adv human
RP-1133M Recombinant Mouse CD3d / CD3 delta Protein (Fc Tag) 20μg 572 € adv mouse
AE51397SH-48 ELISA test for Sheep T-cell surface glycoprotein CD3 delta chain (CD3D) 1x plate of 48 wells 402 € abebio sheep
AE51397SH Sheep T-cell surface glycoprotein CD3 delta chain (CD3D) ELISA Kit 96 wells plate 859 € ab-elisa elisas sheep
AE51397SH-96 Sheep T-cell surface glycoprotein CD3 delta chain (CD3D) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
RP-1175RC Recombinant Cynomolgus CD3D & CD3E Heterodimer Protein 20μg 624 € adv human
MBS623808 DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) Antibody 200ul 603 € MBS Polyclonals_1 human
CS24 Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His) 50 µg 369 € novo human
CM98 Recombinant Cynomolgus PDCD1, PD-1, CD279 (C-6His) 10 µg 146 € novo human
CP02 Recombinant Cynomolgus TIGIT, VSIG9, VSTM3 (C-6His) 500 µg 1613 € novo human
RP-0326H Recombinant Human CD3D & CD3E Heterodimer Protein 20μg 572 € adv human
RP-1614M Recombinant Mouse CD3D & CD3E Heterodimer Protein 20μg 572 € adv mouse
C578 Recombinant Human CD3 ε, CD3E (C-6His) 50 µg 369 € novo human
OBT4316F CD3, polymorphic, Clone: FN-18, Mouse Monoclonal antibody-Rhesus, Baboon, Cynomolgus, Stumptail, African Green Monkey, Rhesus Macaque (polymorphic epitope), NO X w/Orangutan, Gorilla, Marmoset or Chimpanzee, FITC; flow vial Ask price € accurate-monoclonals chimpanzee
MEDCLA346 CD3, Clone: CD3-12, Rat Mouse Monoclonal antibody-Human, Mouse, Chicken, Dog, Horse; frozen/paraffin 1000ul Ask price € accurate-monoclonals horse
DEV102-11-2/02 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse 200ug 448 € accurate-monoclonals mouse
DEV102-11-2/1 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse 1 mg Ask price € accurate-monoclonals mouse
DEV102-11-3/02 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse, Biotin 200ug 448 € accurate-monoclonals mouse
DEV102-11-3/1 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse, Biotin 1 mg Ask price € accurate-monoclonals mouse
DEV102-11-4/02 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse, FITC 200ug 448 € accurate-monoclonals mouse
DEV102-11-4/1 CD3, Clone: CD3-H5, Rat Mouse Monoclonal antibody-Mouse, FITC 1 mg Ask price € accurate-monoclonals mouse
YSRTMCA1477F CD3 Epsilon (T3), Clone: CD3-12, Rat Mouse Monoclonal antibody-Mouse; flow: FITC 0.1 mg 475 € accurate-monoclonals mouse
YSRTMCA1477FT CD3 Epsilon (T3), Clone: CD3-12, Rat Mouse Monoclonal antibody-Mouse; flow: FITC 25 ug 149 € accurate-monoclonals mouse
YM1098 CD3, T-Cell (mature), 19-29kD, Clone: CD3-12, Mouse Monoclonal antibody-Hu, Ms, Sw, Dog, Cat, Chick, Hrs, frozen/cells/paraffin 1000ul Ask price € accurate-monoclonals cat
YSRTMCA1477 CD3, T-Cell (mature), TCR associated Ag, Thymocyte, Clone: CD3-12, Rat Mouse Monoclonal antibody-Hu,Ms,Dg, Hrs,Ch,Sw; frozen/paraffin, IH/flw/WB 200ug 617 € accurate-monoclonals mouse
YSRTMCA1477T CD3, T-Cell (mature), TCR associated Ag, Thymocyte, Clone: CD3-12, Rat Mouse Monoclonal antibody-Hu,Ms,Dg, Hrs,Ch,Sw; frozen/paraffin, IH/flw/WB 0.02 mg Ask price € accurate-monoclonals mouse