| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 79 kD |
| UniProt number: |
P07766 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD3E (C-6His), CD3 &epsilon |
| Short name: |
CD3E (C-6His), Recombinant CD3 &epsilon |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD3e molecule, epsilon (CD3-TCR complex) (C-6His), sapiens CD3 &epsilon, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD3E and IDBG-631260 and ENSBTAG00000015710 and 281054, CD3E and IDBG-73617 and ENSG00000198851 and 916, Cd3e and IDBG-159085 and ENSMUSG00000032093 and 12501, Cell surfaces, IMD18 and T3E and TCRE, epsilon (CD3-TCR complex), protein heterodimerization activity, this GO :0001772 and immunological synapse and cellular component this GO :0002669 and positive regulation of T cell anergy and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007172 and signal complex assembly and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0017124 and SH3 domain binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0030159 and receptor signaling complex scaffold activity and molecular function this GO :0031295 and T cell costimulation and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032753 and positive regulation of interleukin-4 production and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042101 and T cell receptor complex and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042105 and alpha-beta T cell receptor complex and cellular component this GO :0042110 and T cell activation and biological process this GO :0042608 and T cell receptor binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045879 and negative regulation of smoothened signaling pathway and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0046649 and lymphocyte activation and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0017124 : SH3 domain binding and also this GO :0019901 : protein kinase binding and also this GO :0030159 : receptor signaling complex scaffold activity and also this GO :0042608 : T cell receptor binding and also this GO :0046982 : protein heterodimerization activity, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0017124 : SH3 domain binding, this GO :0019901 : protein kinase binding, this GO :0030159 : receptor signaling complex scaffold activity, this GO :0042608 : T cell receptor binding, this GO :0046982 : protein heterodimerization activity, CD3e molecule |
| Identity: |
1674 |
| Gene: |
CD3E |
More about : CD3E |
| Long gene name: |
CD3e molecule |
| Synonyms gene name: |
CD3e antigen, epsilon (CD3-TCR complex) , epsilon polypeptide (TiT3 complex) CD3e molecule |
| Locus: |
11q23, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
X03884 |
| Entrez gene record: |
916 |
| RefSeq identity: |
NM_000733 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000166968 |
| Locus Specific Databases: |
CD3Ebase: Mutation registry for autosomal recessive CD3epsilon immunodeficiency LRG_38 |