Recombinant Human CD3 ε, CD3E (C-6His)

Contact us
Catalog number: C578
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human CD3 ε, CD3E (C-6His)
Quantity: 1000ul
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a 6His tag at the C-terminus
Molecular Weight: 12, 79 kD
UniProt number: P07766
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD3E (C-6His), CD3 &epsilon
Short name: CD3E (C-6His), Recombinant CD3 &epsilon
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD3e molecule, epsilon (CD3-TCR complex) (C-6His), sapiens CD3 &epsilon, recombinant H
Alternative technique: rec
Alternative to gene target: CD3E and IDBG-631260 and ENSBTAG00000015710 and 281054, CD3E and IDBG-73617 and ENSG00000198851 and 916, Cd3e and IDBG-159085 and ENSMUSG00000032093 and 12501, Cell surfaces, IMD18 and T3E and TCRE, epsilon (CD3-TCR complex), protein heterodimerization activity, this GO :0001772 and immunological synapse and cellular component this GO :0002669 and positive regulation of T cell anergy and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007172 and signal complex assembly and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0017124 and SH3 domain binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0030159 and receptor signaling complex scaffold activity and molecular function this GO :0031295 and T cell costimulation and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032753 and positive regulation of interleukin-4 production and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042101 and T cell receptor complex and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042105 and alpha-beta T cell receptor complex and cellular component this GO :0042110 and T cell activation and biological process this GO :0042608 and T cell receptor binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045879 and negative regulation of smoothened signaling pathway and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0046649 and lymphocyte activation and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0017124 : SH3 domain binding and also this GO :0019901 : protein kinase binding and also this GO :0030159 : receptor signaling complex scaffold activity and also this GO :0042608 : T cell receptor binding and also this GO :0046982 : protein heterodimerization activity, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0017124 : SH3 domain binding, this GO :0019901 : protein kinase binding, this GO :0030159 : receptor signaling complex scaffold activity, this GO :0042608 : T cell receptor binding, this GO :0046982 : protein heterodimerization activity, CD3e molecule
Identity: 1674
Gene: CD3E | More about : CD3E
Long gene name: CD3e molecule
Synonyms gene name: CD3e antigen, epsilon (CD3-TCR complex) , epsilon polypeptide (TiT3 complex) CD3e molecule
Locus: 11q23, 3
Discovery year: 1986-01-01
GenBank acession: X03884
Entrez gene record: 916
RefSeq identity: NM_000733
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000166968
Locus Specific Databases: CD3Ebase: Mutation registry for autosomal recessive CD3epsilon immunodeficiency LRG_38

Related Products :

C578 Recombinant Human CD3 ε, CD3E (C-6His) 50 µg 369 € novo human
MBS621351 Casein Kinase 1 epsilon (Casein Kinase I epsilon, Casein Kinase I Isoform epsilon, CKI epsilon, CKIe, CK1 epsilon, CSNK1E, HCKIE, KC1E, Kinase CK1 epsilon, MGC10398) Antibody 100ug 735 € MBS Polyclonals_1 human
GWB-EADFBF CD3E Antigen Epsilon Poly peptide sequence (TiT3 Complex) (CD3E) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 648 € genways human
CP19 Recombinant Human CD3 ε, CD3E (C-Fc) 1 mg 2283 € novo human
RP-0330H Recombinant Human CD3e / CD3 epsilon Protein (His & Fc Tag) 20μg 624 € adv human
RP-0331H Recombinant Human CD3e / CD3 epsilon Protein (His Tag) 20μg 572 € adv human
RP-1047RC Recombinant Rhesus CD3e / CD3 epsilon Protein (Fc Tag) 20μg 572 € adv rhesus
RP-1046RC Recombinant Rhesus CD3e / CD3 epsilon Protein (His Tag) 20μg 572 € adv rhesus
MBS280064 Anti-Human T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) PAb 100ug 520 € MBS Polyclonals_1 human
GENTAUR-58bdc75757780 Anti- T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc757d4b70 Anti- T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd2e90183d Anti- T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddd67bdc2d Anti- T-Cell Surface Glycoprotein CD3 Epsilon (CD3e) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdaeb011b46 Bovine T-cell surface glycoprotein CD3 epsilon chain (CD3E) 100ug 1348 € MBS Recombinant Proteins bovine
GENTAUR-58bdaeb06eddc Bovine T-cell surface glycoprotein CD3 epsilon chain (CD3E) 1000ug 1348 € MBS Recombinant Proteins bovine
GENTAUR-58bdaeb154a05 Bovine T-cell surface glycoprotein CD3 epsilon chain (CD3E) 100ug 1851 € MBS Recombinant Proteins bovine
GENTAUR-58bdaeb1b3033 Bovine T-cell surface glycoprotein CD3 epsilon chain (CD3E) 1000ug 1851 € MBS Recombinant Proteins bovine
AE51389SH-48 ELISA test for Sheep T-cell surface glycoprotein CD3 epsilon chain (CD3E) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58bd779717d5b Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E) 100ug 1354 € MBS Recombinant Proteins pig
GENTAUR-58bd779783226 Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E) 1000ug 1354 € MBS Recombinant Proteins pig
GENTAUR-58bd77984e580 Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E) 100ug 1857 € MBS Recombinant Proteins pig
GENTAUR-58bd7798b18c7 Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E) 1000ug 1857 € MBS Recombinant Proteins pig
AE51389SH Sheep T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit 48 wells plate 525 € ab-elisa elisas sheep
AE51389SH-96 Sheep T-cell surface glycoprotein CD3 epsilon chain (CD3E) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
C165 Recombinant Human Protein Kinase C Type ε, PKC ε, PKCE (C-6His) 500 µg 1613 € novo human
YSRTMCA1477F CD3 Epsilon (T3), Clone: CD3-12, Rat Mouse Monoclonal antibody-Mouse; flow: FITC 0.1 mg 475 € accurate-monoclonals mouse
YSRTMCA1477FT CD3 Epsilon (T3), Clone: CD3-12, Rat Mouse Monoclonal antibody-Mouse; flow: FITC 25 ug 149 € accurate-monoclonals mouse
CS63 Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His) 1 mg 2283 € novo human
MBS624161 IKBE, phosphorylated (Ser22) (NFKBIE, NF-kappa-B Inhibitor epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon) Antibody 50ug 481 € MBS Polyclonals_1 human
MEDCLA346 CD3, Clone: CD3-12, Rat Mouse Monoclonal antibody-Human, Mouse, Chicken, Dog, Horse; frozen/paraffin 1000ul Ask price € accurate-monoclonals horse