Recombinant Cynomolgus TIGIT, VSIG9, VSTM3 (C-6His)

Contact us
Catalog number: CP02
Price: 659 €
Supplier: adv
Product name: Recombinant Cynomolgus TIGIT, VSIG9, VSTM3 (C-6His)
Quantity: 100μg
Other quantities: 1 mg 2283€ 50 µg 303€
Related search:

More details :

Reacts with: Cynomolgus monkey
Source: proteins, Recombinants or rec
Description: Recombinant Cynomolgus monkey TIGIT is produced by our Mammalian expression system and the target gene encoding Met89-Pro209 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 2 kD
UniProt number: G7NXM4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: VSIG9, VSTM3 (C-6His), Cynomolgus TIGIT
Short name: VSIG9, VSTM3 (C-6His), Recombinant Cynomolgus TIGIT
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: VSIG9, VSTM3 (C-6His), recombinant Cynomolgus T cellular immunoreceptor including Ig and ITIM domains
Alternative technique: rec
Alternative to gene target: Cell surfaces, TIGIT and IDBG-50851 and ENSG00000181847 and 201633, TIGIT and IDBG-632631 and ENSBTAG00000011921 and 100140801, Tigit and IDBG-161101 and ENSMUSG00000071552 and 100043314, protein binding, this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032695 and negative regulation of interleukin-12 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0050868 and negative regulation of T cell activation and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, T cell immunoreceptor with Ig and ITIM domains
Identity: 26838
Gene: TIGIT | More about : TIGIT
Long gene name: T-cell immunoreceptor with Ig and ITIM domains
Synonyms gene: VSIG9 VSTM3
Synonyms gene name: V-set and immunoglobulin domain containing 9 V-set and transmembrane domain containing 3 T cell immunoreceptor with Ig and ITIM domains
Synonyms: FLJ39873 DKFZp667A205
Locus: 3q13, 31
Discovery year: 2006-02-07
GenBank acession: AK097192
Entrez gene record: 201633
Pubmed identfication: 19011627
RefSeq identity: NM_173799
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000159331

Related Products :

CP02 Recombinant Cynomolgus TIGIT, VSIG9, VSTM3 (C-6His) 500 µg 1613 € novo human
CJ58 Recombinant Human TIGIT, VSIG9, VSTM3 (C-6His) 10 µg 202 € novo human
CK55 Recombinant Mouse TIGIT, VSIG9, VSTM3 (C-6His) 1 mg 1674 € novo mouse
CS15 Recombinant Mouse TIGIT, VSIG9, VSTM3 (C-Fc) 50 µg 303 € novo mouse
RP-1506H Recombinant Human TIGIT / VSTM3 Protein (His Tag) 10μg 624 € adv human
RP-1549M Recombinant Mouse TIGIT / VSTM3 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1550M Recombinant Mouse TIGIT / VSTM3 Protein (His Tag) 50μg 624 € adv mouse
CS92 Recombinant Human T-cell immunoreceptor with Ig and ITIM domains, TIGIT (C-Fc) 500 µg 1613 € novo human
CS63 Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His) 1 mg 2283 € novo human
CS24 Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His) 50 µg 369 € novo human
CM98 Recombinant Cynomolgus PDCD1, PD-1, CD279 (C-6His) 10 µg 146 € novo human
GENTAUR-58bdc6ad9209f Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc6adea66d Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 50ug 404 € MBS Polyclonals human
GENTAUR-58bdd006909d2 Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd006f24e8 Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd2a8998fd Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 580 € MBS Polyclonals human
GENTAUR-58bdd322704c1 Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 569 € MBS Polyclonals human
GENTAUR-58bdd4ded654f Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bddaef3e019 Anti- T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) Antibody 100ug 625 € MBS Polyclonals human
abx936783 Anti-TIGIT siRNA 30 nmol 717 € abbex human
EKU08370 T-Cell Immunoreceptor With Ig And ITIM Domains Protein (TIGIT) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
F53798-0.05ML TIGIT Antibody 0.05 ml 199 € NJS poly human
F53798-0.2ML TIGIT Antibody 0.2 ml 406 € NJS poly human
LV334620 TIGIT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
GWB-A9D214 TIGIT Over-expression Lysate reagent 1 vial 463 € genways human
RP-1170RC Recombinant Cynomolgus 14-3-3 beta / YWHAB Protein 20μg 572 € adv human
RP-1005RC Recombinant Cynomolgus ACVR2B / ACTRIIB Protein 50μg 456 € adv human
RP-1007RC Recombinant Cynomolgus ACVR2B / ACTRIIB Protein (Fc Tag) 100μg 624 € adv human
RP-1006RC Recombinant Cynomolgus ACVR2B / ACTRIIB Protein (His Tag) 100μg 624 € adv human
RP-1010RC Recombinant Cynomolgus ALCAM Protein (His Tag) 100μg 659 € adv human