| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
38, 7 kD |
| UniProt number: |
P07766 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD3E (C-Fc), CD3 &epsilon |
| Short name: |
CD3E (C-Fc), Recombinant CD3 &epsilon |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD3e molecule, epsilon (CD3-TCR complex) (C-fragment c), sapiens CD3 &epsilon, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD3E and IDBG-631260 and ENSBTAG00000015710 and 281054, CD3E and IDBG-73617 and ENSG00000198851 and 916, Cd3e and IDBG-159085 and ENSMUSG00000032093 and 12501, Cell surfaces, IMD18 and T3E and TCRE, epsilon (CD3-TCR complex), protein heterodimerization activity, this GO :0001772 and immunological synapse and cellular component this GO :0002669 and positive regulation of T cell anergy and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007172 and signal complex assembly and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0017124 and SH3 domain binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0030159 and receptor signaling complex scaffold activity and molecular function this GO :0031295 and T cell costimulation and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032753 and positive regulation of interleukin-4 production and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042101 and T cell receptor complex and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042105 and alpha-beta T cell receptor complex and cellular component this GO :0042110 and T cell activation and biological process this GO :0042608 and T cell receptor binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045879 and negative regulation of smoothened signaling pathway and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0046649 and lymphocyte activation and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0017124 : SH3 domain binding and also this GO :0019901 : protein kinase binding and also this GO :0030159 : receptor signaling complex scaffold activity and also this GO :0042608 : T cell receptor binding and also this GO :0046982 : protein heterodimerization activity, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0017124 : SH3 domain binding, this GO :0019901 : protein kinase binding, this GO :0030159 : receptor signaling complex scaffold activity, this GO :0042608 : T cell receptor binding, this GO :0046982 : protein heterodimerization activity, CD3e molecule |
| Identity: |
1674 |
| Gene: |
CD3E |
More about : CD3E |
| Long gene name: |
CD3e molecule |
| Synonyms gene name: |
CD3e antigen, epsilon (CD3-TCR complex) , epsilon polypeptide (TiT3 complex) CD3e molecule |
| Locus: |
11q23, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
X03884 |
| Entrez gene record: |
916 |
| RefSeq identity: |
NM_000733 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000166968 |
| Locus Specific Databases: |
CD3Ebase: Mutation registry for autosomal recessive CD3epsilon immunodeficiency LRG_38 |