| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Spondin2 is produced by our Mammalian expression system and the target gene encoding Gln27-Val331 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
34, 4 kD |
| UniProt number: |
Q9BUD6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
Mindin(C-6His), SPON2, Spondin 2 |
| Short name: |
Mindin(C-6His), SPON2, Recombinant Spondin 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Mindin(C-6His), extracellular matrix protein, sapiens Spondin 2, spondin 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, DIL-1 and DIL1 and M-SPONDIN and MINDIN, Extracellular, SPON2 and IDBG-6462 and ENSG00000159674 and 100130872, Spon2 and IDBG-152784 and ENSMUSG00000037379 and 100689, extracellular matrix protein, metal ion binding, this GO :0001530 and lipopolysaccharide binding and molecular function this GO :0002448 and mast cell mediated immunity and biological process this GO :0003823 and antigen binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007411 and axon guidance and biological process this GO :0008228 and opsonization and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0043152 and induction of bacterial agglutination and biological process this GO :0045087 and innate immune response and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050832 and defense response to fungus and biological process this GO :0051607 and defense response to virus and biological process this GO :0060907 and positive regulation of macrophage cytokine production and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process, this GO :0001530 : lipopolysaccharide binding, this GO :0001530 : lipopolysaccharide binding and also this GO :0003823 : antigen binding and also this GO :0005515 : protein binding and also this GO :0046872 : metal ion binding, this GO :0003823 : antigen binding, this GO :0005515 : protein binding, this GO :0046872 : metal ion binding, 10417, 18280 and IDBG-643872 and ENSBTAG00000004261 and 513844, spondin 2 |
| Identity: |
11253 |
| Gene: |
SPON2 |
More about : SPON2 |
| Long gene name: |
spondin 2 |
| Synonyms gene name: |
extracellular matrix protein , spondin 2 |
| Synonyms: |
DIL1 |
| Synonyms name: |
Mindin M-spondin |
| Locus: |
4p16, 3 |
| Discovery year: |
1999-06-18 |
| GenBank acession: |
AB027466 |
| Entrez gene record: |
10417 |
| Pubmed identfication: |
10512675 15094111 |
| Havana BLAST/BLAT: |
OTTHUMG00000089002 |