Recombinant Human Spondin 2, SPON2, Mindin(C-6His)

Contact us
Catalog number: CM63
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Spondin 2, SPON2, Mindin(C-6His)
Quantity: 0.1ml
Other quantities: 10 µg 126€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Spondin2 is produced by our Mammalian expression system and the target gene encoding Gln27-Val331 is expressed with a 6His tag at the C-terminus
Molecular Weight: 34, 4 kD
UniProt number: Q9BUD6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Mindin(C-6His), SPON2, Spondin 2
Short name: Mindin(C-6His), SPON2, Recombinant Spondin 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Mindin(C-6His), extracellular matrix protein, sapiens Spondin 2, spondin 2, recombinant H
Alternative technique: rec
Alternative to gene target: BT, DIL-1 and DIL1 and M-SPONDIN and MINDIN, Extracellular, SPON2 and IDBG-6462 and ENSG00000159674 and 100130872, Spon2 and IDBG-152784 and ENSMUSG00000037379 and 100689, extracellular matrix protein, metal ion binding, this GO :0001530 and lipopolysaccharide binding and molecular function this GO :0002448 and mast cell mediated immunity and biological process this GO :0003823 and antigen binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007411 and axon guidance and biological process this GO :0008228 and opsonization and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0043152 and induction of bacterial agglutination and biological process this GO :0045087 and innate immune response and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050832 and defense response to fungus and biological process this GO :0051607 and defense response to virus and biological process this GO :0060907 and positive regulation of macrophage cytokine production and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process, this GO :0001530 : lipopolysaccharide binding, this GO :0001530 : lipopolysaccharide binding and also this GO :0003823 : antigen binding and also this GO :0005515 : protein binding and also this GO :0046872 : metal ion binding, this GO :0003823 : antigen binding, this GO :0005515 : protein binding, this GO :0046872 : metal ion binding, 10417, 18280 and IDBG-643872 and ENSBTAG00000004261 and 513844, spondin 2
Identity: 11253
Gene: SPON2 | More about : SPON2
Long gene name: spondin 2
Synonyms gene name: extracellular matrix protein , spondin 2
Synonyms: DIL1
Synonyms name: Mindin M-spondin
Locus: 4p16, 3
Discovery year: 1999-06-18
GenBank acession: AB027466
Entrez gene record: 10417
Pubmed identfication: 10512675 15094111
Havana BLAST/BLAT: OTTHUMG00000089002

Related Products :

CM63 Recombinant Human Spondin 2, SPON2, Mindin(C-6His) 10 µg 126 € novo human
abx576073 Anti-Human Spondin 2 (SPON2) ELISA Kit inquire 50 € abbex human
DL-SPON2-Hu Human Spondin 2 SPON2 ELISA Kit 96T 904 € DL elisas human
abx571834 Anti-Mouse Spondin 2 (SPON2) ELISA Kit inquire 50 € abbex mouse
abx571805 Anti-Rat Spondin 2 (SPON2) ELISA Kit 96 tests 833 € abbex rat
GENTAUR-58be5ab5aaf30 Anti-SPON2/M spondin/Mindin, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
AP20171PU-N anti-Spondin 2 / SPON2 Antibody 0,1 mg 558 € acr human
GENTAUR-58bdcce165045 Anti- Spondin 2 (SPON2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdcce1e68f4 Anti- Spondin 2 (SPON2) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd04f6ce07 Anti- Spondin 2 (SPON2) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd0504b739 Anti- Spondin 2 (SPON2) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd1b9a07fa Anti- Spondin 2 (SPON2) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd24ed1a57 Anti- Spondin 2 (SPON2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd6dced810 Anti- Spondin 2 (SPON2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd78a48633 Anti- Spondin 2 (SPON2) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bd9514bbab1 Mouse Spondin-2 (Spon2) 100ug 1884 € MBS Recombinant Proteins mouse
GENTAUR-58bd951523cd2 Mouse Spondin-2 (Spon2) 1000ug 1884 € MBS Recombinant Proteins mouse
GENTAUR-58bd95157b3ba Mouse Spondin-2 (Spon2) 100ug 2398 € MBS Recombinant Proteins mouse
GENTAUR-58bd95162735d Mouse Spondin-2 (Spon2) 1000ug 2398 € MBS Recombinant Proteins mouse
DL-SPON2-Mu Mouse Spondin 2 SPON2 ELISA Kit 96T 921 € DL elisas mouse
DL-SPON2-Ra Rat Spondin 2 SPON2 ELISA Kit 96T 962 € DL elisas rat
bs-11064R-A350 SPON2/M spondin/Mindin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11064R-A488 SPON2/M spondin/Mindin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11064R-A555 SPON2/M spondin/Mindin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11064R-A594 SPON2/M spondin/Mindin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11064R-A647 SPON2/M spondin/Mindin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11064R-Biotin SPON2/M spondin/Mindin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11064R SPON2/M spondin/Mindin Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11064R-Cy3 SPON2/M spondin/Mindin Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11064R-Cy5 SPON2/M spondin/Mindin Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human