Recombinant Human PRL

Contact us
Catalog number: CM10
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human PRL
Quantity: 0.12 ml
Other quantities: 10 µg 141€ 50 µg 303€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is expressed with a 6His tag at the C-terminus
Molecular Weight: 23, 9 kD
UniProt number: P01236
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRL
Short name: Recombinant PRL
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens PRL, recombinant H
Alternative technique: rec
Identity: 9445
Gene: PRL | More about : PRL
Long gene name: prolactin
Locus: 6p22, 3
Discovery year: 1986-01-01
GenBank acession: D00411
Entrez gene record: 5617
RefSeq identity: NM_000948
Classification: Growth hormone family
Havana BLAST/BLAT: OTTHUMG00000016111

Related Products :

GENTAUR-58be2f88edef2 HRP conjugated Mouse anti-Human Prolactin (PRL) monoclonal antibody [PRL-2] 200ul 580 € MBS mono human
GENTAUR-58be2fcb61c80 Mouse anti-Human Prolactin (PRL) monoclonal antibody [PRL-1] 500ug 542 € MBS mono human
MBS611410 Prolactin Receptor, Intermediate isoform (PRLR, PRL-R, PRL Receptor) 100ug 663 € MBS Polyclonals_1 human
GWB-91C8C8 PRL-1(2-173), Active Human recombinant protein 1 vial 470 € genways human
GWB-PS8370 PRL-2(2-167), Active Human recombinant protein 1 vial 470 € genways human
GWB-PSF243 PRL-3(2-173), Active Human recombinant protein 1 vial 470 € genways human
C777 Recombinant Human PRL- 2, PTP4A2 (C-6His) 50 µg 303 € novo human
RP-1254H Recombinant Human PRL-2 / PTP4A2 Protein (GST Tag) 20μg 572 € adv human
CM10 Recombinant Human PRL 1 mg 1674 € novo human
AR50007PU-N anti-Prolactin / PRL (recombinant) Antibody 0,5 mg 1109 € acr human
AR50007PU-S anti-Prolactin / PRL (recombinant) Antibody 0,1 mg 485 € acr human
GWB-P1640B PRL-3, 1-173 aa, Recombinant Protein bulk Ask price € genways bulk human
RP-1630M Recombinant Mouse PRL / Prolactin Protein (His Tag) 50μg 346 € adv mouse
AE25906HU-48 ELISA test for Human Prolactin (PRL) 1x plate of 48 wells 251 € abebio human
AP50027HU-100ug Human PRL Protein 0.1mg 234 € abebio human
AP50027HU-1mg Human PRL Protein 1mg 940 € abebio human
AP50027HU Human Prolactin (PRL) 0.1mg 803 € AbELISA Rec human
AE25906HU Human Prolactin (PRL) ELISA Kit 48 wells plate 333 € ab-elisa elisas human
AE25906HU-96 Human Prolactin (PRL) ELISA Kit 1x plate of 96 wells 368 € abebio human
DL-PRL-Hu Human Prolactin PRL ELISA Kit 96T 672 € DL elisas human
LV273283 PRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-5C51F2 PRL R Human bulk Ask price € genways bulk human
GWB-F48250 PRL-R Human bulk Ask price € genways bulk human
GENTAUR-58bb57124f3bb Anguilla anguilla Prolactin (prl) 100ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bb5712917b2 Anguilla anguilla Prolactin (prl) 1000ug 1586 € MBS Recombinant Proteins human
GENTAUR-58bb5712d7a6c Anguilla anguilla Prolactin (prl) 100ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bb571318281 Anguilla anguilla Prolactin (prl) 1000ug 2089 € MBS Recombinant Proteins human
GENTAUR-58bdf00e6b405 Anti- PRL Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf00ec301d Anti- PRL Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf83bd88cd Anti- PRL Antibody 0.12 ml 348 € MBS Polyclonals human