| Catalog number: | CM10 |
|---|---|
| Price: | 348 € |
| Supplier: | MBS Polyclonals |
| Product name: | Recombinant Human PRL |
| Quantity: | 0.12 ml |
| Other quantities: | 1 mg 1674€ 10 µg 141€ 50 µg 303€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 23, 9 kD |
| UniProt number: | P01236 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | PRL |
| Short name: | Recombinant PRL |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | sapiens PRL, recombinant H |
| Alternative technique: | rec |
| Identity: | 9445 |
| Gene: | PRL | More about : PRL |
| Long gene name: | prolactin |
| Locus: | 6p22, 3 |
| Discovery year: | 1986-01-01 |
| GenBank acession: | D00411 |
| Entrez gene record: | 5617 |
| RefSeq identity: | NM_000948 |
| Classification: | Growth hormone family |
| Havana BLAST/BLAT: | OTTHUMG00000016111 |
| GENTAUR-58be2f88edef2 | HRP conjugated Mouse anti-Human Prolactin (PRL) monoclonal antibody [PRL-2] | 200ul | 580 € | MBS mono | human |
| GENTAUR-58be2fcb61c80 | Mouse anti-Human Prolactin (PRL) monoclonal antibody [PRL-1] | 500ug | 542 € | MBS mono | human |
| MBS611410 | Prolactin Receptor, Intermediate isoform (PRLR, PRL-R, PRL Receptor) | 100ug | 663 € | MBS Polyclonals_1 | human |
| GWB-91C8C8 | PRL-1(2-173), Active Human recombinant protein | 1 vial | 470 € | genways | human |
| GWB-PS8370 | PRL-2(2-167), Active Human recombinant protein | 1 vial | 470 € | genways | human |
| GWB-PSF243 | PRL-3(2-173), Active Human recombinant protein | 1 vial | 470 € | genways | human |
| C777 | Recombinant Human PRL- 2, PTP4A2 (C-6His) | 50 µg | 303 € | novo | human |
| RP-1254H | Recombinant Human PRL-2 / PTP4A2 Protein (GST Tag) | 20μg | 572 € | adv | human |
| CM10 | Recombinant Human PRL | 1 mg | 1674 € | novo | human |
| AR50007PU-N | anti-Prolactin / PRL (recombinant) Antibody | 0,5 mg | 1109 € | acr | human |
| AR50007PU-S | anti-Prolactin / PRL (recombinant) Antibody | 0,1 mg | 485 € | acr | human |
| GWB-P1640B | PRL-3, 1-173 aa, Recombinant Protein | bulk | Ask price € | genways bulk | human |
| RP-1630M | Recombinant Mouse PRL / Prolactin Protein (His Tag) | 50μg | 346 € | adv | mouse |
| AE25906HU-48 | ELISA test for Human Prolactin (PRL) | 1x plate of 48 wells | 251 € | abebio | human |
| AP50027HU-100ug | Human PRL Protein | 0.1mg | 234 € | abebio | human |
| AP50027HU-1mg | Human PRL Protein | 1mg | 940 € | abebio | human |
| AP50027HU | Human Prolactin (PRL) | 0.1mg | 803 € | AbELISA Rec | human |
| AE25906HU | Human Prolactin (PRL) ELISA Kit | 48 wells plate | 333 € | ab-elisa elisas | human |
| AE25906HU-96 | Human Prolactin (PRL) ELISA Kit | 1x plate of 96 wells | 368 € | abebio | human |
| DL-PRL-Hu | Human Prolactin PRL ELISA Kit | 96T | 672 € | DL elisas | human |
| LV273283 | PRL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| GWB-5C51F2 | PRL R Human | bulk | Ask price € | genways bulk | human |
| GWB-F48250 | PRL-R Human | bulk | Ask price € | genways bulk | human |
| GENTAUR-58bb57124f3bb | Anguilla anguilla Prolactin (prl) | 100ug | 1586 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb5712917b2 | Anguilla anguilla Prolactin (prl) | 1000ug | 1586 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb5712d7a6c | Anguilla anguilla Prolactin (prl) | 100ug | 2089 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb571318281 | Anguilla anguilla Prolactin (prl) | 1000ug | 2089 € | MBS Recombinant Proteins | human |
| GENTAUR-58bdf00e6b405 | Anti- PRL Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdf00ec301d | Anti- PRL Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58bdf83bd88cd | Anti- PRL Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |