| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ECH1 is produced by our E, coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
34, 45 kD |
| UniProt number: |
Q13011 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ECH1, Mitochondrial, &delta, (2, (3, 4) Dienoyl-CoA Isomerase, 5) &delta |
| Short name: |
ECH1, Mitochondrial, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, Recombinant &delta |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
ECH1, Mitochondrial, sapiens &delta, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, recombinant H |
| Alternative technique: |
rec |
| Identity: |
3149 |
| Gene: |
ECH1 |
More about : ECH1 |
| Long gene name: |
enoyl-CoA hydratase 1 |
| Synonyms gene name: |
enoyl Coenzyme A hydratase 1, peroxisomal , peroxisomal enoyl-CoA hydratase 1 |
| Synonyms: |
HPXEL |
| Synonyms name: |
delta3, 4-dienoyl-coenzyme A isomerase peroxisomal enoyl-CoA hydratase 1 , 5-delta2 |
| Locus: |
19q13, 2 |
| Discovery year: |
1995-04-26 |
| GenBank acession: |
U16660 |
| Entrez gene record: |
1891 |
| Pubmed identfication: |
7558027 |
| Havana BLAST/BLAT: |
OTTHUMG00000182609 |