Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial, ECH1

Contact us
Catalog number: CK08
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial, ECH1
Quantity: 1.0 µg DNA
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ECH1 is produced by our E, coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus
Molecular Weight: 34, 45 kD
UniProt number: Q13011
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ECH1, Mitochondrial, &delta, (2, (3, 4) Dienoyl-CoA Isomerase, 5) &delta
Short name: ECH1, Mitochondrial, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, Recombinant &delta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: ECH1, Mitochondrial, sapiens &delta, (2, (3, 4)-Dienoyl-CoA Isomerase, 5)-&delta, recombinant H
Alternative technique: rec
Identity: 3149
Gene: ECH1 | More about : ECH1
Long gene name: enoyl-CoA hydratase 1
Synonyms gene name: enoyl Coenzyme A hydratase 1, peroxisomal , peroxisomal enoyl-CoA hydratase 1
Synonyms: HPXEL
Synonyms name: delta3, 4-dienoyl-coenzyme A isomerase peroxisomal enoyl-CoA hydratase 1 , 5-delta2
Locus: 19q13, 2
Discovery year: 1995-04-26
GenBank acession: U16660
Entrez gene record: 1891
Pubmed identfication: 7558027
Havana BLAST/BLAT: OTTHUMG00000182609

Related Products :

CK08 Recombinant Human δ(3,5)-δ(2,4)-Dienoyl-CoA Isomerase, Mitochondrial, ECH1 10 µg 156 € novo human
GENTAUR-58bd2203e1639 Mouse Delta (3,5) -Delta (2,4) -dienoyl-CoA isomerase, mitochondrial (Ech1) 100ug 1857 € MBS Recombinant Proteins mouse
GENTAUR-58bd22043a398 Mouse Delta (3,5) -Delta (2,4) -dienoyl-CoA isomerase, mitochondrial (Ech1) 1000ug 1857 € MBS Recombinant Proteins mouse
GENTAUR-58bd220474394 Mouse Delta (3,5) -Delta (2,4) -dienoyl-CoA isomerase, mitochondrial (Ech1) 100ug 2371 € MBS Recombinant Proteins mouse
GENTAUR-58bd2204b9505 Mouse Delta (3,5) -Delta (2,4) -dienoyl-CoA isomerase, mitochondrial (Ech1) 1000ug 2371 € MBS Recombinant Proteins mouse
GENTAUR-58bdaae08d094 Human 2,4-dienoyl-CoA reductase, mitochondrial (DECR1) 100ug 1873 € MBS Recombinant Proteins human
GENTAUR-58bdaae10c522 Human 2,4-dienoyl-CoA reductase, mitochondrial (DECR1) 1000ug 1873 € MBS Recombinant Proteins human
GENTAUR-58bdaae15ccb6 Human 2,4-dienoyl-CoA reductase, mitochondrial (DECR1) 100ug 2387 € MBS Recombinant Proteins human
GENTAUR-58bdaae1ca4c0 Human 2,4-dienoyl-CoA reductase, mitochondrial (DECR1) 1000ug 2387 € MBS Recombinant Proteins human
GENTAUR-58bd5c0e023de Human Peroxisomal 2,4-dienoyl-CoA reductase (DECR2) 100ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bd5c0e3c951 Human Peroxisomal 2,4-dienoyl-CoA reductase (DECR2) 1000ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bd5c0e884db Human Peroxisomal 2,4-dienoyl-CoA reductase (DECR2) 100ug 2359 € MBS Recombinant Proteins human
GENTAUR-58bd5c0ecbf08 Human Peroxisomal 2,4-dienoyl-CoA reductase (DECR2) 1000ug 2359 € MBS Recombinant Proteins human
GENTAUR-58bd78dddd9b2 Arabidopsis thaliana Peroxisomal 2,4-dienoyl-CoA reductase (At3g12800) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58bd78de2601d Arabidopsis thaliana Peroxisomal 2,4-dienoyl-CoA reductase (At3g12800) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58bd78de69086 Arabidopsis thaliana Peroxisomal 2,4-dienoyl-CoA reductase (At3g12800) 100ug 2382 € MBS Recombinant Proteins human
GENTAUR-58bd78deb4ddc Arabidopsis thaliana Peroxisomal 2,4-dienoyl-CoA reductase (At3g12800) 1000ug 2382 € MBS Recombinant Proteins human
GENTAUR-58bc51e6ddf2d Escherichia coli 2,4-dienoyl-CoA reductase [NADPH] (fadH) 100ug 2824 € MBS Recombinant Proteins human
GENTAUR-58bc51e72cfcf Escherichia coli 2,4-dienoyl-CoA reductase [NADPH] (fadH) 1000ug 2824 € MBS Recombinant Proteins human
GENTAUR-58bc51e7ca98f Escherichia coli 2,4-dienoyl-CoA reductase [NADPH] (fadH) 100ug 3288 € MBS Recombinant Proteins human
GENTAUR-58bc51e8208fb Escherichia coli 2,4-dienoyl-CoA reductase [NADPH] (fadH) 1000ug 3288 € MBS Recombinant Proteins human
MBS617469 a-Methylacyl CoA Racemase (Alpha Methylacyl CoA Racemase, Alpha Methylacyl Coenzyme A Racemase, AMACR, 2-Arylpropionyl CoA Epimerase, 2-Methylacyl CoA Racemase, EC 5.1.99.4, Macr1, Methylacyl CoA Racemase alpha, P504S, RACE) Antibody 500ul 696 € MBS Polyclonals_1 human
RP-0588H Recombinant Human ECH1 Protein (His Tag) 20μg 572 € adv human
GWB-P1327A ECH1, 34-328aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP170 ECH1 Human Protein bulk Ask price € genways bulk human
LV144627 ECH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV144628 ECH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV144629 ECH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV144630 ECH1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV144632 ECH1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human