Recombinant Human OX40 Ligand, TNFSF4, OX40L (N-6His)

Contact us
Catalog number: CJ45
Price: 1186 €
Supplier: novo
Product name: Recombinant Human OX40 Ligand, TNFSF4, OX40L (N-6His)
Quantity: 500 µg
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 16, 3 kD
UniProt number: P23510
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: OX40L (N-6His), TNFSF4, OX40 Ligand
Short name: OX40L (N-6His), TNFSF4, Recombinant OX40 Ligand
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: OX40L (N-6His), member 4, sapiens OX40 Ligand, tumor necrosis factor (ligand) superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: CD134L and CD252 and GP34 and OX-40L and OX4OL and TXGP1, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0050710 and negative regulation of cytokine secretion and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050871 and positive regulation of B cell activation and biological process this GO :0051024 and positive regulation of immunoglobulin secretion and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071380 and cellular response to prostaglandin E stimulus and biological process this GO :0071954 and chemokine (C-C motif) ligand 11 production and biological process this GO :1900281 and positive regulation of CD4-positive, Extracellular, TNFSF4 and IDBG-104864 and ENSG00000117586 and 7292, TNFSF4 and IDBG-632319 and ENSBTAG00000002894 and 539800, Tnfsf4 and IDBG-201525 and ENSMUSG00000026700 and 22164, alpha beta T cell costimulation and biological process this GO :2000525 and positive regulation of T cell costimulation and biological process this GO :2000568 and positive regulation of memory T cell activation and biological process this GO :2000570 and positive regulation of T-helper 2 cell activation and biological process this GO :2000572 and positive regulation of interleukin-4-dependent isotype switching to IgE isotypes and biological process, alpha-beta T cell costimulation and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0043372 and positive regulation of CD4-positive, alpha-beta T cell differentiation and biological process this GO :0043382 and positive regulation of memory T cell differentiation and biological process this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045590 and negative regulation of regulatory T cell differentiation and biological process this GO :0045626 and negative regulation of T-helper 1 cell differentiation and biological process this GO :0045630 and positive regulation of T-helper 2 cell differentiation and biological process this GO :0045892 and negative regulation of transcription, member 4, this GO :0001816 and cytokine production and biological process this GO :0002215 and defense response to nematode and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0002726 and positive regulation of T cell cytokine production and biological process this GO :0002819 and regulation of adaptive immune response and biological process this GO :0002830 and positive regulation of type 2 immune response and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032700 and negative regulation of interleukin-17 production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032736 and positive regulation of interleukin-13 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0032753 and positive regulation of interleukin-4 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0035709 and memory T cell activation and biological process this GO :0035712 and T-helper 2 cell activation and biological process this GO :0035713 and response to nitrogen dioxide and biological process this GO :0035714 and cellular response to nitrogen dioxide and biological process this GO :0035783 and CD4-positive, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily
Identity: 11934
Gene: TNFSF4 | More about : TNFSF4
Long gene name: tumor necrosis factor superfamily member 4
Synonyms gene: TXGP1
Synonyms gene name: 34kD tumor necrosis factor (ligand) superfamily, member 4 , tax-transcriptionally activated glycoprotein 1
Synonyms: OX-40L gp34 CD252
Locus: 1q25, 1
Discovery year: 1993-12-15
GenBank acession: D90224
Entrez gene record: 7292
Pubmed identfication: 1996093 8076595
Classification: Tumor necrosis factor superfamily CD molecules
Havana BLAST/BLAT: OTTHUMG00000034838

Related Products :

CJ45 Recombinant Human OX40 Ligand, TNFSF4, OX40L (N-6His) 50 µg 496 € novo human
CM74 Recombinant Mouse OX40 Ligand, TNFSF4, OX40L (N-8His) 50 µg 369 € novo mouse
GENTAUR-58be31b07a1ab CD134 Ligand (CD134L, OX40L, CD252) (FITC) 120 Tests 691 € MBS mono human
GENTAUR-58be31b01535b CD134 Ligand (CD134L, OX40L, CD252) (FITC) Antibody 120 Tests 691 € MBS mono human
CK60 Recombinant Human OX40, TNFRSF4, CD134 (C-6His) 500 µg 1186 € novo human
ZR-40-317 OX40 Ligand Recombinant Protein 0.002 mg 256 € Zyagen human
CK54 Recombinant Mouse OX40, TNFRSF4, CD134 (C-6His) 1 mg 1674 € novo mouse
DL-TNFSF4-Hu Human Tumor Necrosis Factor Ligand Superfamily, Member 4 TNFSF4 ELISA Kit 96T 788 € DL elisas human
GENTAUR-58b83782c067c Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4) 100ug 1475 € MBS Recombinant Proteins human
GENTAUR-58b8378335782 Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4) 1000ug 1475 € MBS Recombinant Proteins human
GENTAUR-58b837839c85a Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4) 100ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b837841c80e Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4) 1000ug 1978 € MBS Recombinant Proteins human
EKU07968 Tumor Necrosis Factor Ligand Superfamily, Member 4 (TNFSF4) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
MEDCLA853 CD134, OX40 Ligand, Clone: 102H6, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/No WB 1000ul Ask price € accurate-monoclonals human
YSRTMCA1881XZ CD252, OX40 Ligand, Clone: MRC OX89, Rat Mouse Monoclonal antibody-Mouse, azide-free; functional assays 1 mg 1059 € accurate-monoclonals mouse
YSRTMCA1881 CD252, OX40 Ligand, Clone: MRC OX89, Rat Mouse Monoclonal antibody-Mouse; flow 0.25 mg 391 € accurate-monoclonals mouse
GENTAUR-58be3a55d6253 OX40 Ligand antibody 100ug 382 € MBS mono human
GENTAUR-58be3a5641d30 OX40 Ligand antibody 50ug 293 € MBS mono human
GENTAUR-58be398fb9ce9 OX40 Ligand antibody (biotin) 50ug 299 € MBS mono human
GENTAUR-58be39902c02c OX40 Ligand antibody (biotin) 100ug 404 € MBS mono human
GENTAUR-58be378a5f4cc OX40 Ligand antibody (PE) 100ug 525 € MBS mono human
GENTAUR-58be378ac11d2 OX40 Ligand antibody (PE) 50ug 370 € MBS mono human
MBS612868 APRIL, ED2 (a Proliferation Inducing Ligand, TALL-2, TNF and ApoL-related Leukocyte-expressed Ligand 2, TRDL-1a, TNF-related Death Ligand 1a, TNFSF13) Antibody 100ug 569 € MBS Polyclonals_1 human
RP-1159H Recombinant Human OX-40L / TNFSF4 / CD252 Protein (Fc Tag) 10μg 456 € adv human
abx253194 Anti-Human soluble OX40L ELISA Kit inquire 50 € abbex human
AE13973HU-48 ELISA test for Human Soluble OX40L (sOX40L) 1x plate of 48 wells 402 € abebio human
AE13973HU Human Soluble OX40L (sOX40L) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE13973HU-96 Human Soluble OX40L (sOX40L) ELISA Kit 1x plate of 96 wells 671 € abebio human
CK58 Recombinant Human OX40, TNFRSF4, CD134 (C-Fc) 500 µg 1186 € novo human
CK59 Recombinant Human OX40, TNFRSF4, CD134 (N-Fc) 500 µg 1186 € novo human