| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight: |
17, 7 kD |
| UniProt number: |
P43488 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HHHHHHHHSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
OX40L (N-8His), TNFSF4, OX40 Ligand |
| Short name: |
OX40L (N-8His), TNFSF4, Recombinant Mouse OX40 Ligand |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
OX40L (N-8His), member 4, tumor necrosis factor (ligand) superfamily, recombinant Mouse OX40 Ligand |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD134L and CD252 and GP34 and OX-40L and OX4OL and TXGP1, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0050710 and negative regulation of cytokine secretion and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050871 and positive regulation of B cell activation and biological process this GO :0051024 and positive regulation of immunoglobulin secretion and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071380 and cellular response to prostaglandin E stimulus and biological process this GO :0071954 and chemokine (C-C motif) ligand 11 production and biological process this GO :1900281 and positive regulation of CD4-positive, Extracellular, TNFSF4 and IDBG-104864 and ENSG00000117586 and 7292, TNFSF4 and IDBG-632319 and ENSBTAG00000002894 and 539800, Tnfsf4 and IDBG-201525 and ENSMUSG00000026700 and 22164, alpha beta T cell costimulation and biological process this GO :2000525 and positive regulation of T cell costimulation and biological process this GO :2000568 and positive regulation of memory T cell activation and biological process this GO :2000570 and positive regulation of T-helper 2 cell activation and biological process this GO :2000572 and positive regulation of interleukin-4-dependent isotype switching to IgE isotypes and biological process, alpha-beta T cell costimulation and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0043372 and positive regulation of CD4-positive, alpha-beta T cell differentiation and biological process this GO :0043382 and positive regulation of memory T cell differentiation and biological process this GO :0043433 and negative regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0045590 and negative regulation of regulatory T cell differentiation and biological process this GO :0045626 and negative regulation of T-helper 1 cell differentiation and biological process this GO :0045630 and positive regulation of T-helper 2 cell differentiation and biological process this GO :0045892 and negative regulation of transcription, member 4, this GO :0001816 and cytokine production and biological process this GO :0002215 and defense response to nematode and biological process this GO :0002526 and acute inflammatory response and biological process this GO :0002726 and positive regulation of T cell cytokine production and biological process this GO :0002819 and regulation of adaptive immune response and biological process this GO :0002830 and positive regulation of type 2 immune response and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032700 and negative regulation of interleukin-17 production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0032736 and positive regulation of interleukin-13 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0032753 and positive regulation of interleukin-4 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0035709 and memory T cell activation and biological process this GO :0035712 and T-helper 2 cell activation and biological process this GO :0035713 and response to nitrogen dioxide and biological process this GO :0035714 and cellular response to nitrogen dioxide and biological process this GO :0035783 and CD4-positive, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily |
| Identity: |
11934 |
| Gene: |
TNFSF4 |
More about : TNFSF4 |
| Long gene name: |
tumor necrosis factor superfamily member 4 |
| Synonyms gene: |
TXGP1 |
| Synonyms gene name: |
34kD tumor necrosis factor (ligand) superfamily, member 4 , tax-transcriptionally activated glycoprotein 1 |
| Synonyms: |
OX-40L gp34 CD252 |
| Locus: |
1q25, 1 |
| Discovery year: |
1993-12-15 |
| GenBank acession: |
D90224 |
| Entrez gene record: |
7292 |
| Pubmed identfication: |
1996093 8076595 |
| Classification: |
Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000034838 |