Recombinant Human Prion-Like Protein Doppel, PRND (C-6His)

Contact us
Catalog number: CJ22
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human Prion-Like Protein Doppel, PRND (C-6His)
Quantity: 100ul
Other quantities: 1 mg 2283€ 10 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Prion-like protein doppel is produced by our Mammalian expression system and the target gene encoding Arg27-Gly152 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 5 kD
UniProt number: Q9UKY0
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRND (C-6His), Prion-Like Protein Doppel
Short name: PRND (C-6His), Recombinant Prion-Like Protein Doppel
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PRND (C-6His), sapiens Prion-Like Protein Doppel, recombinant H
Alternative technique: rec
Identity: 15748
Gene: PRND | More about : PRND
Long gene name: prion like protein doppel
Synonyms gene name: prion protein 2 (dublet)
Synonyms: DPL dJ1068H6, 4 DOPPEL PrPLP
Synonyms name: prion-like protein doppel downstream prion protein-like gene
Locus: 20p13
Discovery year: 2001-05-30
GenBank acession: AF106918
Entrez gene record: 23627
Pubmed identfication: 10525406 10577243
RefSeq identity: NM_012409
Havana BLAST/BLAT: OTTHUMG00000031789

Related Products :

CJ22 Recombinant Human Prion-Like Protein Doppel, PRND (C-6His) 500 µg 1613 € novo human
AE25845HU-48 ELISA test for Human Prion-like protein doppel (PRND) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bda2601654e Human Prion-like protein doppel (PRND) 100ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bda2607b8ab Human Prion-like protein doppel (PRND) 1000ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bda260eb0b1 Human Prion-like protein doppel (PRND) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bda2616d3fe Human Prion-like protein doppel (PRND) 1000ug 1940 € MBS Recombinant Proteins human
AE25845HU-96 Human Prion-like protein doppel (PRND) ELISA Kit 1x plate of 96 wells 612 € abebio human
GENTAUR-58bdb5044bc2a Bovine Prion-like protein doppel (PRND) 100ug 1442 € MBS Recombinant Proteins bovine
GENTAUR-58bdb504aa35b Bovine Prion-like protein doppel (PRND) 1000ug 1442 € MBS Recombinant Proteins bovine
GENTAUR-58bdb505264ba Bovine Prion-like protein doppel (PRND) 100ug 1945 € MBS Recombinant Proteins bovine
GENTAUR-58bdb5058eb58 Bovine Prion-like protein doppel (PRND) 1000ug 1945 € MBS Recombinant Proteins bovine
AE58004SH-48 ELISA test for Sheep Prion-like protein doppel (PRND) 1x plate of 48 wells 402 € abebio sheep
AE58004SH Sheep Prion-like protein doppel (PRND) ELISA Kit 96 wells plate 810 € ab-elisa elisas sheep
AE58004SH-96 Sheep Prion-like protein doppel (PRND) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
RP-1753H Recombinant Human PRND / Prion protein 2 Protein (His Tag) 20μg 572 € adv human
abx250777 Anti-Human Prion-like protein doppel ELISA Kit 96 tests 659 € abbex human
abx254932 Anti-Mouse Prion-like protein doppel ELISA Kit 96 tests 659 € abbex mouse
AR50748PU-N anti-Prion protein 2 / PRND (27-152, His-tag) Antibody 0,1 mg 1109 € acr human
AR50748PU-S anti-Prion protein 2 / PRND (27-152, His-tag) Antibody 20 Вµg 485 € acr human
GWB-PPST12 PRND, 27-152aa Human, His tag, E.coli bulk Ask price € genways bulk human
LV273565 Prnd Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be54357ea65 Anti- PRND Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be543605160 Anti- PRND Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be54366906f Anti- PRND Antibody 100ug 387 € MBS Polyclonals human
abx929859 Anti-PRND siRNA inquire 50 € abbex human
abx929860 Anti-PRND siRNA inquire 50 € abbex human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58be5ba17e838 Anti-Doppel/DPL (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-11732R-A350 Doppel/DPL Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11732R-A488 Doppel/DPL Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human