Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 (C-6His)

Contact us
Catalog number: CI83
Price: 2283 €
Supplier: novo
Product name: Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 780€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 11, 3 kD
UniProt number: P02775
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 4, 150 mM sodium chloride, 2 um filtered solution of 20 mMHAc-Nac, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESADVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL7, NAP-2 (C-6His), C-X-C Motif Chemokine 7
Short name: CXCL7, NAP-2 (C-6His), Recombinant C-X-C Motif Chemokine 7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CXCL7, NAP-2 (C-6His), sapiens C-X-C Motif Chemokine 7, recombinant H
Alternative technique: rec
Identity: 9240
Gene: PPBP | More about : PPBP
Long gene name: pro-platelet basic protein
Synonyms gene: THBGB1
Synonyms: SCYB7 TGB NAP-2-L1 LA-PF4 MDGF LDGF Beta-TG CTAP3 CXCL7 PBP b-TG1 TGB1 CTAPIII NAP-2
Synonyms name: platelet basic protein beta-thromboglobulin connective tissue-activating peptide III neutrophil-activating peptide-2 chemokine (C-X-C motif) ligand 7
Locus: 4q13, 3
Discovery year: 1991-05-21
GenBank acession: M54995
Entrez gene record: 5473
Pubmed identfication: 1826003
RefSeq identity: NM_002704
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000130008

Related Products :

CI83 Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 (C-6His) 10 µg 100 € novo human
C056 Recombinant Human C-X-C Motif Chemokine 7, CXCL7, NAP-2 500 µg 1613 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
GWB-BIG0E3 Recombinant Human NAP-2 (CXCL7) bulk Ask price € genways bulk human
RP-2216R Recombinant Rat NAP-2 / PPBP / CXCL7 Protein (His Tag) 20μg 572 € adv rat
RP-1192RC Recombinant Rhesus NAP-2 / PPBP / CXCL7 Protein (His Tag) 20μg 572 € adv rhesus
101-M81 Anti-Human NAP-2 (CXCL7) 500ug 310 € Reliatech antibodies human
R31872 NAP-2 Antibody / CXCL7 0.1mg 406 € NJS poly human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58b817cf5fae0 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b817d11a352 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b817d157458 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b817d1bbb6d Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b84140aa491 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b841410949e Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 1868 € MBS Recombinant Proteins human
GENTAUR-58b84141493c8 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 100ug 2382 € MBS Recombinant Proteins human
GENTAUR-58b8414194b27 Bacillus subtilis Uncharacterized carboxylesterase nap (nap) 1000ug 2382 € MBS Recombinant Proteins human
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CC43 Recombinant Human C-C Motif Chemokine 24, CCL24, Eotaxin-2, MPIF-2 (C-6His) 1 mg 2283 € novo human