| Catalog number: | CI34 |
|---|---|
| Price: | 333 € |
| Supplier: | Bioss Primary Conjugated Antibodies |
| Product name: | Recombinant Human NPDC1, CAB1 (C-6His) |
| Quantity: | 0.1ml |
| Other quantities: | 10 µg 146€ 50 µg 303€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 16, 5 kD |
| UniProt number: | Q9NQX5 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | CAB1 (C-6His), NPDC1 |
| Short name: | CAB1 (C-6His), Recombinant NPDC1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | CAB1 (C-6His), sapiens NPDC1, recombinant H |
| Alternative technique: | rec |
| Identity: | 7899 |
| Gene: | NPDC1 | More about : NPDC1 |
| Long gene name: | differentiation and control 1 , neural proliferation |
| Synonyms: | DKFZp586J0523 CAB- CAB1 |
| Locus: | 9q34, 3 |
| Discovery year: | 2000-08-11 |
| GenBank acession: | AF285836 |
| Entrez gene record: | 56654 |
| Pubmed identfication: | 11245976 |
| RefSeq identity: | NM_015392 |
| Havana BLAST/BLAT: | OTTHUMG00000020956 |
| CI34 | Recombinant Human NPDC1, CAB1 (C-6His) | 50 µg | 303 € | novo | human |
| MBS622782 | NPDC-1 (Neural proliferation, differentiation and control, 1 CAB, CAB-, CAB1, CAB-1, DKFZp586J0523, Neural proliferation differentiation and control protein 1, NPDC-1) (Biotin) | 50ug | 818 € | MBS Polyclonals_1 | human |
| GENTAUR-58ba31494e5b5 | Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) | 1000ug | 1647 € | MBS Recombinant Proteins | human |
| GENTAUR-58ba3149eb641 | Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) | 1000ug | 2155 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb7544ebe99 | Zea mays Chlorophyll a-b binding protein 1, chloroplastic (CAB1) | 1000ug | 1652 € | MBS Recombinant Proteins | human |
| GENTAUR-58bb75454813c | Zea mays Chlorophyll a-b binding protein 1, chloroplastic (CAB1) | 1000ug | 2155 € | MBS Recombinant Proteins | human |
| GWB-ASE757 | Human NPDC1 Antibody | bulk | Ask price € | genways bulk | human |
| MBS248892 | PAb (IgG) to Human NPDC1 | 50ug | 597 € | MBS Polyclonals_1 | human |
| A03N0107 | anti-NPDC1 Antibody | 200ug (50ug, 100ug available) | 465 € | Bluegen antibodies | human |
| AM05343PU-N | anti-NPDC1 Antibody | 0,1 mg | 601 € | acr | human |
| C16901-1 | anti-NPDC1 Antibody | 50 Вµg | 347 € | acr | human |
| C16901-2 | anti-NPDC1 Antibody | 0,1 mg | 500 € | acr | human |
| abx217117 | Anti-NPDC1 Antibody | 200 μg | 369 € | abbex | human |
| abx162621 | Anti-NPDC1 Blocking Peptide | 5 mg | 427 € | abbex | human |
| GENTAUR-58be5be241ae6 | Anti-NPDC1 (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx926223 | Anti-NPDC1 siRNA | 30 nmol | 717 € | abbex | human |
| abx926224 | Anti-NPDC1 siRNA | 15 nmol | 528 € | abbex | human |
| GWB-MQ670D | NPDC1 antibody | 1 vial | 440 € | genways | human |
| bs-11913R-A350 | NPDC1 Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-11913R-A488 | NPDC1 Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-11913R-A555 | NPDC1 Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-11913R-A594 | NPDC1 Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-11913R-A647 | NPDC1 Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-11913R-Biotin | NPDC1 Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bs-11913R | NPDC1 Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| bs-11913R-Cy3 | NPDC1 Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-11913R-Cy5 | NPDC1 Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-11913R-Cy5.5 | NPDC1 Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-11913R-Cy7 | NPDC1 Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bs-11913R-FITC | NPDC1 Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |