Recombinant Human NPDC1, CAB1 (C-6His)

Contact us
Catalog number: CI34
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human NPDC1, CAB1 (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NPDC1 is produced by our Mammalian expression system and the target gene encoding Gly35-Asp181 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 5 kD
UniProt number: Q9NQX5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CAB1 (C-6His), NPDC1
Short name: CAB1 (C-6His), Recombinant NPDC1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CAB1 (C-6His), sapiens NPDC1, recombinant H
Alternative technique: rec
Identity: 7899
Gene: NPDC1 | More about : NPDC1
Long gene name: differentiation and control 1 , neural proliferation
Synonyms: DKFZp586J0523 CAB- CAB1
Locus: 9q34, 3
Discovery year: 2000-08-11
GenBank acession: AF285836
Entrez gene record: 56654
Pubmed identfication: 11245976
RefSeq identity: NM_015392
Havana BLAST/BLAT: OTTHUMG00000020956

Related Products :

CI34 Recombinant Human NPDC1, CAB1 (C-6His) 50 µg 303 € novo human
MBS622782 NPDC-1 (Neural proliferation, differentiation and control, 1 CAB, CAB-, CAB1, CAB-1, DKFZp586J0523, Neural proliferation differentiation and control protein 1, NPDC-1) (Biotin) 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58ba31494e5b5 Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) 1000ug 1647 € MBS Recombinant Proteins human
GENTAUR-58ba3149eb641 Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bb7544ebe99 Zea mays Chlorophyll a-b binding protein 1, chloroplastic (CAB1) 1000ug 1652 € MBS Recombinant Proteins human
GENTAUR-58bb75454813c Zea mays Chlorophyll a-b binding protein 1, chloroplastic (CAB1) 1000ug 2155 € MBS Recombinant Proteins human
GWB-ASE757 Human NPDC1 Antibody bulk Ask price € genways bulk human
MBS248892 PAb (IgG) to Human NPDC1 50ug 597 € MBS Polyclonals_1 human
A03N0107 anti-NPDC1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM05343PU-N anti-NPDC1 Antibody 0,1 mg 601 € acr human
C16901-1 anti-NPDC1 Antibody 50 Вµg 347 € acr human
C16901-2 anti-NPDC1 Antibody 0,1 mg 500 € acr human
abx217117 Anti-NPDC1 Antibody 200 μg 369 € abbex human
abx162621 Anti-NPDC1 Blocking Peptide 5 mg 427 € abbex human
GENTAUR-58be5be241ae6 Anti-NPDC1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx926223 Anti-NPDC1 siRNA 30 nmol 717 € abbex human
abx926224 Anti-NPDC1 siRNA 15 nmol 528 € abbex human
GWB-MQ670D NPDC1 antibody 1 vial 440 € genways human
bs-11913R-A350 NPDC1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11913R-A488 NPDC1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11913R-A555 NPDC1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11913R-A594 NPDC1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11913R-A647 NPDC1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11913R-Biotin NPDC1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11913R NPDC1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11913R-Cy3 NPDC1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11913R-Cy5 NPDC1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11913R-Cy5.5 NPDC1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11913R-Cy7 NPDC1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11913R-FITC NPDC1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human