Recombinant Human Haptoglobin, Zonulin (N-6His)

Contact us
Catalog number: CH71
Price: 760 €
Supplier: abbex
Product name: Recombinant Human Haptoglobin, Zonulin (N-6His)
Quantity: 96 tests
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Haptoglobin/Zonulin is produced by our E, coli expression system and the target gene encoding Cys145-Asn406 is expressed with a 6His tag at the N-terminus
Molecular Weight: 31, 4 kD
UniProt number: P00738
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMCEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Zonulin (N-6His), Haptoglobin
Short name: Zonulin (N-6His), Recombinant Haptoglobin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Zonulin (N-6His), sapiens Haptoglobin, recombinant H
Alternative technique: rec

Related Products :

CD97 Recombinant Human Haptoglobin, Zonulin (C-6His) 50 µg 496 € novo human
CH71 Recombinant Human Haptoglobin, Zonulin (N-6His) 10 µg 202 € novo human
AP02266SU-N anti-Zonulin (GGVLVQPG) Antibody 0,1 ml 775 € acr human
AP02266SU-S anti-Zonulin (GGVLVQPG) Antibody 20 Вµl 297 € acr human
MBS622563 Zonulin 20ul 509 € MBS Polyclonals_1 human
RP-978 Recombinant (E.Coli) Human Haptoglobin (>95%, his-tag, ~33 kda 5 μg 188 € adi human
abx262754 Anti-Haptoglobin (19-347 a.a) Protein (Recombinant) 1 mg 6662 € abbex human
abx166290 Anti-Haptoglobin Protein (Recombinant) 50 μg 644 € abbex human
abx167513 Anti-Haptoglobin Protein (Recombinant) 50 μg 615 € abbex human
abx168012 Anti-Haptoglobin Protein (Recombinant) 100 μg 920 € abbex human
abx168566 Anti-Haptoglobin Protein (Recombinant) 100 μg 891 € abbex human
abx260629 Anti-Haptoglobin Protein (Recombinant) 5 µg 238 € abbex human
abx166021 Anti-Haptoglobin Related Protein (Recombinant) 50 μg 615 € abbex human
abx167883 Anti-Haptoglobin Related Protein (Recombinant) 50 μg 572 € abbex human
abx262749 Anti-Haptoglobin-Related Protein (Recombinant) 2 µg 238 € abbex human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
CC79 Recombinant Human GM-CSF, CSF2 (C-6His, Human Cells) 10 µg 146 € novo human
CD98 Recombinant Human NGAL, Lipocalin-2, LCN2 (C-6His, Human Cells) 500 µg 1613 € novo human
CB01 Recombinant Human SOD2, Mn-SOD (C-6His, Human Cells) 500 µg 1613 € novo human
MBS560357 Affinity Purified Goat anti-Human Haptoglobin 1000ug 243 € MBS Polyclonals_1 human
GWB-431F61 Anti-Haptoglobin (Human) Affinity-Purified Polyclonal IgY Antibodies bulk Ask price € genways bulk human
abx190137 Anti-Human Haptoglobin CLIA Kit inquire 50 € abbex human
abx151772 Anti-Human Haptoglobin ELISA Kit inquire 50 € abbex human
abx250298 Anti-Human Haptoglobin ELISA Kit inquire 50 € abbex human
GHPT-80A anti-Human Haptoglobin Host: Goat Unconjugated A.P. 1.0 mg 141 € icl human
RHPT-80A anti-Human Haptoglobin Host: Rabbit Unconjugated A.P. 1.0 mg 187 € icl human
abx574240 Anti-Human Haptoglobin (Hpt) ELISA Kit 96 tests 586 € abbex human
abx190347 Anti-Human Haptoglobin Related Protein CLIA Kit 96 tests 1079 € abbex human
abx253722 Anti-Human Haptoglobin-related protein ELISA Kit 96 tests 557 € abbex human
abx573491 Anti-Human Haptoglobin Related Protein (HPR) ELISA Kit 96 tests 760 € abbex human