| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Krueppel-like factor 6 is produced by our E, coli expression system and the target gene encoding Met1-Ser109 is expressed |
| Molecular Weight: |
12, 6 kD |
| UniProt number: |
Q99612 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
KLF6, Krueppel-Like Factor 6 |
| Short name: |
KLF6, Recombinant Krueppel-Like Factor 6 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Kruppel-like factor 6, sapiens Krueppel-Like Factor 6, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BCD1 and CBA1 and COPEB and CPBP and GBF and PAC1 and ST12 and ZF9, DNA-templated and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0046872 and metal ion binding and molecular function, KLF6 and IDBG-46758 and ENSG00000067082 and 1316, KLF6 and IDBG-639502 and ENSBTAG00000015188 and, Klf6 and IDBG-128907 and ENSMUSG00000000078 and 23849, metal ion binding, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006351 and transcription, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0046872 : metal ion binding, this GO :0046872 : metal ion binding, Kruppel-like factor 6 |
| Identity: |
2235 |
| Gene: |
KLF6 |
More about : KLF6 |
| Long gene name: |
Kruppel like factor 6 |
| Synonyms gene: |
BCD1 ST12 COPEB |
| Synonyms gene name: |
core promoter element binding protein |
| Synonyms: |
CPBP GBF Zf9 PAC1 |
| Synonyms name: |
GC-rich binding factor |
| Locus: |
10p15, 2 |
| Discovery year: |
1997-10-16 |
| GenBank acession: |
U51869 |
| Entrez gene record: |
1316 |
| Pubmed identfication: |
9503030 9685731 |
| Classification: |
Kruppel like factors Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000017567 |