Recombinant Human Krueppel-Like Factor 6, KLF6

Contact us
Catalog number: CH54
Price: 500 €
Supplier: acr
Product name: Recombinant Human Krueppel-Like Factor 6, KLF6
Quantity: 0,1 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Krueppel-like factor 6 is produced by our E, coli expression system and the target gene encoding Met1-Ser109 is expressed
Molecular Weight: 12, 6 kD
UniProt number: Q99612
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KLF6, Krueppel-Like Factor 6
Short name: KLF6, Recombinant Krueppel-Like Factor 6
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Kruppel-like factor 6, sapiens Krueppel-Like Factor 6, recombinant H
Alternative technique: rec
Alternative to gene target: BCD1 and CBA1 and COPEB and CPBP and GBF and PAC1 and ST12 and ZF9, DNA-templated and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0046872 and metal ion binding and molecular function, KLF6 and IDBG-46758 and ENSG00000067082 and 1316, KLF6 and IDBG-639502 and ENSBTAG00000015188 and, Klf6 and IDBG-128907 and ENSMUSG00000000078 and 23849, metal ion binding, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006351 and transcription, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0046872 : metal ion binding, this GO :0046872 : metal ion binding, Kruppel-like factor 6
Identity: 2235
Gene: KLF6 | More about : KLF6
Long gene name: Kruppel like factor 6
Synonyms gene: BCD1 ST12 COPEB
Synonyms gene name: core promoter element binding protein
Synonyms: CPBP GBF Zf9 PAC1
Synonyms name: GC-rich binding factor
Locus: 10p15, 2
Discovery year: 1997-10-16
GenBank acession: U51869
Entrez gene record: 1316
Pubmed identfication: 9503030 9685731
Classification: Kruppel like factors Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000017567

Related Products :

CH54 Recombinant Human Krueppel-Like Factor 6, KLF6 50 µg 496 € novo human
GENTAUR-58bdbce2eefb1 Human Krueppel-like factor 6 (KLF6) 100ug 1829 € MBS Recombinant Proteins human
GENTAUR-58bdbce373bb1 Human Krueppel-like factor 6 (KLF6) 1000ug 1829 € MBS Recombinant Proteins human
GENTAUR-58bdbce3c8b80 Human Krueppel-like factor 6 (KLF6) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58bdbce43276d Human Krueppel-like factor 6 (KLF6) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58bceb8a9c3d9 Mouse Krueppel-like factor 6 (Klf6) 100ug 1829 € MBS Recombinant Proteins mouse
GENTAUR-58bceb8b492d6 Mouse Krueppel-like factor 6 (Klf6) 1000ug 1829 € MBS Recombinant Proteins mouse
GENTAUR-58bceb8b93851 Mouse Krueppel-like factor 6 (Klf6) 100ug 2343 € MBS Recombinant Proteins mouse
GENTAUR-58bceb8bd1422 Mouse Krueppel-like factor 6 (Klf6) 1000ug 2343 € MBS Recombinant Proteins mouse
MBS618481 KLF4 (Kruppel-like Factor 4, Epithelial Zinc Finger Protein, EZF, Gut-enriched Krueppel-like Factor, GKLF) Antibody 50ug 382 € MBS Polyclonals_1 human
abx250246 Anti-Human Krueppel-like factor 10 ELISA Kit 96 tests 586 € abbex human
abx253745 Anti-Human Krueppel-like factor 13 ELISA Kit inquire 50 € abbex human
abx253747 Anti-Human Krueppel-like factor 14 ELISA Kit 96 tests 659 € abbex human
GENTAUR-58bc69b90d797 Human Krueppel-like factor 11 (KLF11) 100ug 2415 € MBS Recombinant Proteins human
GENTAUR-58bc69b95b48a Human Krueppel-like factor 11 (KLF11) 1000ug 2415 € MBS Recombinant Proteins human
GENTAUR-58bc69b99c089 Human Krueppel-like factor 11 (KLF11) 100ug 2929 € MBS Recombinant Proteins human
GENTAUR-58bc69b9d5451 Human Krueppel-like factor 11 (KLF11) 1000ug 2929 € MBS Recombinant Proteins human
GENTAUR-58ba73528d7b7 Human Krueppel-like factor 7 (KLF7) 100ug 1879 € MBS Recombinant Proteins human
GENTAUR-58ba73531f5da Human Krueppel-like factor 7 (KLF7) 1000ug 1879 € MBS Recombinant Proteins human
GENTAUR-58ba73539390e Human Krueppel-like factor 7 (KLF7) 100ug 2387 € MBS Recombinant Proteins human
GENTAUR-58ba73543baf5 Human Krueppel-like factor 7 (KLF7) 1000ug 2387 € MBS Recombinant Proteins human
GENTAUR-58bc4b5a9f29a Human Krueppel-like factor 8 (KLF8) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bc4b5ad7c70 Human Krueppel-like factor 8 (KLF8) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bc4b5b2e871 Human Krueppel-like factor 8 (KLF8) 100ug 2536 € MBS Recombinant Proteins human
GENTAUR-58bc4b5ba69a7 Human Krueppel-like factor 8 (KLF8) 1000ug 2536 € MBS Recombinant Proteins human
GENTAUR-58bdc0741d791 Mouse Anti-Human Krueppel-like factor 4 Antibody 0.02 miligrams 277 € MBS mono human
GENTAUR-58bdc074701b1 Mouse Anti-Human Krueppel-like factor 4 Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc074a3ba2 Mouse Anti-Human Krueppel-like factor 4 Antibody 0.005 miligrams 205 € MBS mono human
C10971-1 anti-Krueppel-like factor 1 (KLF1) Antibody 50 Вµg 347 € acr human
C10971-2 anti-Krueppel-like factor 1 (KLF1) Antibody 0,1 mg 500 € acr human