| Catalog number: | CG78 |
|---|---|
| Price: | 1912 € |
| Supplier: | MBS Recombinant Proteins |
| Product name: | Recombinant Human Arginase-1, ARG1 (C-6His) |
| Quantity: | 100ug |
| Other quantities: | 1 mg 2486€ 50 µg 496€ 500 µg 1755€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human Arginase-1 is produced by our E, coli expression system and the target gene encoding Met1-lys322 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: | 35, 8 kD |
| UniProt number: | P05089 |
| State of the product: | Liquid |
| Shipping conditions: | Dry Ice/Ice Pack |
| Formulation: | 1 mM DTT, 150 mM sodium chloride, 20% Glycerol, pH 7, 2 um filtered solution of 20 mM Tris, 4, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | ARG1 (C-6His), Arginase-1 |
| Short name: | ARG1 (C-6His), Recombinant Arginase-1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | ARG1 (C-6His), sapiens Arginase-1, recombinant H |
| Alternative technique: | rec |
| Identity: | 663 |
| Gene: | ARG1 | More about : ARG1 |
| Long gene name: | arginase 1 |
| Synonyms gene name: | arginase, liver |
| Locus: | 6q23, 2 |
| Discovery year: | 2001-06-22 |
| Entrez gene record: | 383 |
| Pubmed identfication: | 22959135 |
| Havana BLAST/BLAT: | OTTHUMG00000015566 |
| Locus Specific Databases: | LOVD - Leiden Open Variation Database |
| CG78 | Recombinant Human Arginase-1, ARG1 (C-6His) | 10 µg | 202 € | novo | human |
| RP-0090H | Recombinant Human ARG1 / Arginase 1 Protein (His & MYC Tag) | 10μg | 624 € | adv | human |
| RP-0091H | Recombinant Human ARG1 / Arginase 1 Protein (His Tag) | 10μg | 624 € | adv | human |
| MBS246866 | Anti-Human ARG1 / Arginase 1 | 0.05 ml | 597 € | MBS Polyclonals_1 | human |
| AE55817HU-48 | ELISA test for Human Arginase-1 (ARG1) | 1x plate of 48 wells | 373 € | abebio | human |
| MBS243085 | Goat Polyclonal to Human ARG1 / Arginase 1 Antibody | 50ug | 597 € | MBS Polyclonals_1 | human |
| AE55817HU | Human Arginase-1 (ARG1) ELISA Kit | 48 wells plate | 480 € | ab-elisa elisas | human |
| AE55817HU-96 | Human Arginase-1 (ARG1) ELISA Kit | 1x plate of 96 wells | 612 € | abebio | human |
| GWB-AD3238 | antibody to or anti- Arginase type 1 / ARG1 antibody | 1 vial | 411 € | genways | human |
| F47437-0.08ML | Arginase 1 Antibody (Arg1) | 0.08 ml | 199 € | NJS poly | human |
| F51459-0.08ML | Arginase 1 Antibody (ARG1) | 0.08 ml | 199 € | NJS poly | human |
| GENTAUR-58bd74db366f5 | Bovine Arginase-1 (ARG1) | 100ug | 1929 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58bd74db80f6b | Bovine Arginase-1 (ARG1) | 1000ug | 1929 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58bd74dbca89a | Bovine Arginase-1 (ARG1) | 100ug | 2442 € | MBS Recombinant Proteins | bovine |
| GENTAUR-58bd74dc24f92 | Bovine Arginase-1 (ARG1) | 1000ug | 2442 € | MBS Recombinant Proteins | bovine |
| MBS421120 | Goat anti-Arginase, type 1 / ARG1 Antibody | 100ug | 370 € | MBS Polyclonals_1 | human |
| MBS244523 | Goat Polyclonal to Rat ARG1 / Arginase 1 Antibody | 50ug | 597 € | MBS Polyclonals_1 | rat |
| GENTAUR-58bd74852d782 | Mouse Arginase-1 (Arg1) | 100ug | 1929 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bd74858dd68 | Mouse Arginase-1 (Arg1) | 1000ug | 1929 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bd7485c714e | Mouse Arginase-1 (Arg1) | 100ug | 2442 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bd7486207ee | Mouse Arginase-1 (Arg1) | 1000ug | 2442 € | MBS Recombinant Proteins | mouse |
| GENTAUR-58bd76fdc9bb5 | Pig Arginase-1 (ARG1) | 100ug | 1929 € | MBS Recombinant Proteins | pig |
| GENTAUR-58bd76fe2981a | Pig Arginase-1 (ARG1) | 1000ug | 1929 € | MBS Recombinant Proteins | pig |
| GENTAUR-58bd76fe65a71 | Pig Arginase-1 (ARG1) | 100ug | 2442 € | MBS Recombinant Proteins | pig |
| GENTAUR-58bd76feb9bbc | Pig Arginase-1 (ARG1) | 1000ug | 2442 € | MBS Recombinant Proteins | pig |
| GENTAUR-58b88f763194d | Rat Arginase-1 (Arg1) | 100ug | 1929 € | MBS Recombinant Proteins | rat |
| GENTAUR-58b88f766c718 | Rat Arginase-1 (Arg1) | 1000ug | 1929 € | MBS Recombinant Proteins | rat |
| GENTAUR-58b88f76aedac | Rat Arginase-1 (Arg1) | 100ug | 2442 € | MBS Recombinant Proteins | rat |
| GENTAUR-58b88f770415d | Rat Arginase-1 (Arg1) | 1000ug | 2442 € | MBS Recombinant Proteins | rat |
| GENTAUR-58b9ec4b83d74 | Xenopus laevis Arginase-1 (arg1) | 100ug | 1912 € | MBS Recombinant Proteins | xenopus |