Recombinant Human Arginase-1, ARG1 (C-6His)

Contact us
Catalog number: CG78
Price: 1912 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Arginase-1, ARG1 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Arginase-1 is produced by our E, coli expression system and the target gene encoding Met1-lys322 is expressed with a 6His tag at the C-terminus
Molecular Weight: 35, 8 kD
UniProt number: P05089
State of the product: Liquid
Shipping conditions: Dry Ice/Ice Pack
Formulation: 1 mM DTT, 150 mM sodium chloride, 20% Glycerol, pH 7, 2 um filtered solution of 20 mM Tris, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ARG1 (C-6His), Arginase-1
Short name: ARG1 (C-6His), Recombinant Arginase-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ARG1 (C-6His), sapiens Arginase-1, recombinant H
Alternative technique: rec
Identity: 663
Gene: ARG1 | More about : ARG1
Long gene name: arginase 1
Synonyms gene name: arginase, liver
Locus: 6q23, 2
Discovery year: 2001-06-22
Entrez gene record: 383
Pubmed identfication: 22959135
Havana BLAST/BLAT: OTTHUMG00000015566
Locus Specific Databases: LOVD - Leiden Open Variation Database

Related Products :

CG78 Recombinant Human Arginase-1, ARG1 (C-6His) 10 µg 202 € novo human
RP-0090H Recombinant Human ARG1 / Arginase 1 Protein (His & MYC Tag) 10μg 624 € adv human
RP-0091H Recombinant Human ARG1 / Arginase 1 Protein (His Tag) 10μg 624 € adv human
MBS246866 Anti-Human ARG1 / Arginase 1 0.05 ml 597 € MBS Polyclonals_1 human
AE55817HU-48 ELISA test for Human Arginase-1 (ARG1) 1x plate of 48 wells 373 € abebio human
MBS243085 Goat Polyclonal to Human ARG1 / Arginase 1 Antibody 50ug 597 € MBS Polyclonals_1 human
AE55817HU Human Arginase-1 (ARG1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE55817HU-96 Human Arginase-1 (ARG1) ELISA Kit 1x plate of 96 wells 612 € abebio human
GWB-AD3238 antibody to or anti- Arginase type 1 / ARG1 antibody 1 vial 411 € genways human
F47437-0.08ML Arginase 1 Antibody (Arg1) 0.08 ml 199 € NJS poly human
F51459-0.08ML Arginase 1 Antibody (ARG1) 0.08 ml 199 € NJS poly human
GENTAUR-58bd74db366f5 Bovine Arginase-1 (ARG1) 100ug 1929 € MBS Recombinant Proteins bovine
GENTAUR-58bd74db80f6b Bovine Arginase-1 (ARG1) 1000ug 1929 € MBS Recombinant Proteins bovine
GENTAUR-58bd74dbca89a Bovine Arginase-1 (ARG1) 100ug 2442 € MBS Recombinant Proteins bovine
GENTAUR-58bd74dc24f92 Bovine Arginase-1 (ARG1) 1000ug 2442 € MBS Recombinant Proteins bovine
MBS421120 Goat anti-Arginase, type 1 / ARG1 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS244523 Goat Polyclonal to Rat ARG1 / Arginase 1 Antibody 50ug 597 € MBS Polyclonals_1 rat
GENTAUR-58bd74852d782 Mouse Arginase-1 (Arg1) 100ug 1929 € MBS Recombinant Proteins mouse
GENTAUR-58bd74858dd68 Mouse Arginase-1 (Arg1) 1000ug 1929 € MBS Recombinant Proteins mouse
GENTAUR-58bd7485c714e Mouse Arginase-1 (Arg1) 100ug 2442 € MBS Recombinant Proteins mouse
GENTAUR-58bd7486207ee Mouse Arginase-1 (Arg1) 1000ug 2442 € MBS Recombinant Proteins mouse
GENTAUR-58bd76fdc9bb5 Pig Arginase-1 (ARG1) 100ug 1929 € MBS Recombinant Proteins pig
GENTAUR-58bd76fe2981a Pig Arginase-1 (ARG1) 1000ug 1929 € MBS Recombinant Proteins pig
GENTAUR-58bd76fe65a71 Pig Arginase-1 (ARG1) 100ug 2442 € MBS Recombinant Proteins pig
GENTAUR-58bd76feb9bbc Pig Arginase-1 (ARG1) 1000ug 2442 € MBS Recombinant Proteins pig
GENTAUR-58b88f763194d Rat Arginase-1 (Arg1) 100ug 1929 € MBS Recombinant Proteins rat
GENTAUR-58b88f766c718 Rat Arginase-1 (Arg1) 1000ug 1929 € MBS Recombinant Proteins rat
GENTAUR-58b88f76aedac Rat Arginase-1 (Arg1) 100ug 2442 € MBS Recombinant Proteins rat
GENTAUR-58b88f770415d Rat Arginase-1 (Arg1) 1000ug 2442 € MBS Recombinant Proteins rat
GENTAUR-58b9ec4b83d74 Xenopus laevis Arginase-1 (arg1) 100ug 1912 € MBS Recombinant Proteins xenopus