| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Early growth response protein 1 is produced by our E, coli expression system and the target gene encoding Gln282-Ser433 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
19, 9 kD |
| UniProt number: |
P18146 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
EGR1, ZNF225 (N-6His), Early Growth Response Protein 1 |
| Short name: |
EGR1, ZNF225 (N-6His), Recombinant Early Growth Response Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ZNF225 (N-6His), early growth response 1, sapiens Early Growth Response Protein 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AT225 and G0S30 and KROX-24 and NGFI-A and TIS8 and ZIF-268 and ZNF225, DNA-templated and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0007611 and learning or memory and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0009749 and response to glucose and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0032354 and response to follicle-stimulating hormone and biological process this GO :0032868 and response to insulin and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0033233 and regulation of protein sumoylation and biological process this GO :0034465 and response to carbon monoxide and biological process this GO :0034698 and response to this GO nadotropin and biological process this GO :0035035 and histone acetyltransferase binding and molecular function this GO :0035690 and cellular response to drug and biological process this GO :0035914 and skeletal muscle cell differentiation and biological process this GO :0042220 and response to cocaine and biological process this GO :0042493 and response to drug and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048169 and regulation of long-term neuronal synaptic plasticity and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0060291 and long-term synaptic potentiation and biological process this GO :0060337 and type I interferon signaling pathway and biological process this GO :0070498 and interleukin-1-mediated signaling pathway and biological process this GO :0071236 and cellular response to antibiotic and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071310 and cellular response to organic substance and biological process this GO :0071317 and cellular response to isoquinoline alkaloid and biological process this GO :0071320 and cellular response to cAMP and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071371 and cellular response to this GO nadotropin stimulus and biological process this GO :0071372 and cellular response to follicle-stimulating hormone stimulus and biological process this GO :0071383 and cellular response to steroid hormone stimulus and biological process this GO :0071455 and cellular response to hyperoxia and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0071480 and cellular response to gamma radiation and biological process this GO :0071504 and cellular response to heparin and biological process this GO :0071506 and cellular response to mycophenolic acid and biological process this GO :0071873 and response to norepinephrine and biological process this GO :0072110 and glomerular mesangial cell proliferation and biological process this GO :0072303 and positive regulation of glomerular metanephric mesangial cell proliferation and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process, EGR1 and IDBG-47191 and ENSG00000120738 and 1958, EGR1 and IDBG-645986 and ENSBTAG00000010069 and 407125, Egr1 and IDBG-136414 and ENSMUSG00000038418 and 13653, metal ion binding, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000976 and transcription regulatory region sequence-specific DNA binding and molecular function this GO :0000977 and RNA polymerase II regulatory region sequence-specific DNA binding and molecular function this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0000982 and RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity and molecular function this GO :0001077 and RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and molecular function this GO :0001975 and response to amphetamine and biological process this GO :0003677 and DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006355 and regulation of transcription, this GO :0000976 : transcription regulatory region sequence-specific DNA binding, this GO :0000976 : transcription regulatory region sequence-specific DNA binding and also this GO :0000977 : RNA polymerase II regulatory region sequence-specific DNA binding and also this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0000982 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity and also this GO :0001077 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and also this GO :0003677 : DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0035035 : histone acetyltransferase binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0046872 : metal ion binding, this GO :0000977 : RNA polymerase II regulatory region sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000982 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity, this GO :0001077 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription, this GO :0003677 : DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0035035 : histone acetyltransferase binding, this GO :0043565 : sequence-specific DNA binding, this GO :0044212 : transcription regulatory region DNA binding, this GO :0046872 : metal ion binding, early growth response 1 |
| Identity: |
13018 |
| Gene: |
ZNF225 |
More about : ZNF225 |
| Long gene name: |
zinc finger protein 225 |
| Locus: |
19q13, 31 |
| Discovery year: |
1998-08-13 |
| GenBank acession: |
AF187991 |
| Entrez gene record: |
7768 |
| Classification: |
Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000182336 |