Recombinant Human Early Growth Response Protein 1, EGR1, ZNF225 (N-6His)

Contact us
Catalog number: CG55
Price: 1768 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Early Growth Response Protein 1, EGR1, ZNF225 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Early growth response protein 1 is produced by our E, coli expression system and the target gene encoding Gln282-Ser433 is expressed with a 6His tag at the N-terminus
Molecular Weight: 19, 9 kD
UniProt number: P18146
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EGR1, ZNF225 (N-6His), Early Growth Response Protein 1
Short name: EGR1, ZNF225 (N-6His), Recombinant Early Growth Response Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ZNF225 (N-6His), early growth response 1, sapiens Early Growth Response Protein 1, recombinant H
Alternative technique: rec
Alternative to gene target: AT225 and G0S30 and KROX-24 and NGFI-A and TIS8 and ZIF-268 and ZNF225, DNA-templated and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0007611 and learning or memory and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0009749 and response to glucose and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0032354 and response to follicle-stimulating hormone and biological process this GO :0032868 and response to insulin and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0033233 and regulation of protein sumoylation and biological process this GO :0034465 and response to carbon monoxide and biological process this GO :0034698 and response to this GO nadotropin and biological process this GO :0035035 and histone acetyltransferase binding and molecular function this GO :0035690 and cellular response to drug and biological process this GO :0035914 and skeletal muscle cell differentiation and biological process this GO :0042220 and response to cocaine and biological process this GO :0042493 and response to drug and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048169 and regulation of long-term neuronal synaptic plasticity and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0060291 and long-term synaptic potentiation and biological process this GO :0060337 and type I interferon signaling pathway and biological process this GO :0070498 and interleukin-1-mediated signaling pathway and biological process this GO :0071236 and cellular response to antibiotic and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071310 and cellular response to organic substance and biological process this GO :0071317 and cellular response to isoquinoline alkaloid and biological process this GO :0071320 and cellular response to cAMP and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071371 and cellular response to this GO nadotropin stimulus and biological process this GO :0071372 and cellular response to follicle-stimulating hormone stimulus and biological process this GO :0071383 and cellular response to steroid hormone stimulus and biological process this GO :0071455 and cellular response to hyperoxia and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0071480 and cellular response to gamma radiation and biological process this GO :0071504 and cellular response to heparin and biological process this GO :0071506 and cellular response to mycophenolic acid and biological process this GO :0071873 and response to norepinephrine and biological process this GO :0072110 and glomerular mesangial cell proliferation and biological process this GO :0072303 and positive regulation of glomerular metanephric mesangial cell proliferation and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process, EGR1 and IDBG-47191 and ENSG00000120738 and 1958, EGR1 and IDBG-645986 and ENSBTAG00000010069 and 407125, Egr1 and IDBG-136414 and ENSMUSG00000038418 and 13653, metal ion binding, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000976 and transcription regulatory region sequence-specific DNA binding and molecular function this GO :0000977 and RNA polymerase II regulatory region sequence-specific DNA binding and molecular function this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0000982 and RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity and molecular function this GO :0001077 and RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and molecular function this GO :0001975 and response to amphetamine and biological process this GO :0003677 and DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006355 and regulation of transcription, this GO :0000976 : transcription regulatory region sequence-specific DNA binding, this GO :0000976 : transcription regulatory region sequence-specific DNA binding and also this GO :0000977 : RNA polymerase II regulatory region sequence-specific DNA binding and also this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0000982 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity and also this GO :0001077 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and also this GO :0003677 : DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0035035 : histone acetyltransferase binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0046872 : metal ion binding, this GO :0000977 : RNA polymerase II regulatory region sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000982 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity, this GO :0001077 : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription, this GO :0003677 : DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0035035 : histone acetyltransferase binding, this GO :0043565 : sequence-specific DNA binding, this GO :0044212 : transcription regulatory region DNA binding, this GO :0046872 : metal ion binding, early growth response 1
Identity: 13018
Gene: ZNF225 | More about : ZNF225
Long gene name: zinc finger protein 225
Locus: 19q13, 31
Discovery year: 1998-08-13
GenBank acession: AF187991
Entrez gene record: 7768
Classification: Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000182336

Related Products :

CG55 Recombinant Human Early Growth Response Protein 1, EGR1, ZNF225 (N-6His) 10 µg 202 € novo human
DL-EGR1-Hu Human Early Growth Response Protein 1 EGR1 ELISA Kit 96T 846 € DL elisas human
GWB-E79B00 Early Growth Response 1 (EGR1) Rabbit antibody to or anti-Human Polyclonal (aa94-108) antibody 1 vial 602 € genways human
GENTAUR-58bdd3f60f1bb Anti- Early Growth Response Protein 1 (EGR1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdda322c774 Anti- Early Growth Response Protein 1 (EGR1) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bddab69d107 Anti- Early Growth Response Protein 1 (EGR1) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bddab714b0a Anti- Early Growth Response Protein 1 (EGR1) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bc7e06df3c1 Chicken Early growth response protein 1 (EGR1) 100ug 1597 € MBS Recombinant Proteins chicken
GENTAUR-58bc7e073c4f1 Chicken Early growth response protein 1 (EGR1) 1000ug 1597 € MBS Recombinant Proteins chicken
GENTAUR-58bc7e078ea87 Chicken Early growth response protein 1 (EGR1) 100ug 2111 € MBS Recombinant Proteins chicken
GENTAUR-58bc7e07c976d Chicken Early growth response protein 1 (EGR1) 1000ug 2111 € MBS Recombinant Proteins chicken
AE46013CH Chicken Early growth response protein 1 (EGR1) ELISA Kit 96 wells plate 810 € ab-elisa elisas chicken
AE46013CH-96 Chicken Early growth response protein 1 (EGR1) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
GENTAUR-58ba1c2ac78a8 Coturnix coturnix japonica Early growth response protein 1 (EGR1) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58ba1c2bb61d7 Coturnix coturnix japonica Early growth response protein 1 (EGR1) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58ba1c2c3e0e0 Coturnix coturnix japonica Early growth response protein 1 (EGR1) 100ug 2111 € MBS Recombinant Proteins human
GENTAUR-58ba1c30c0677 Coturnix coturnix japonica Early growth response protein 1 (EGR1) 1000ug 2111 € MBS Recombinant Proteins human
GENTAUR-58ba1c9eb834f Coturnix coturnix japonica Early growth response protein 1 (EGR1) 1000ug 2111 € MBS Recombinant Proteins human
EKU03825 Early Growth Response Protein 1 (EGR1) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU03826 Early Growth Response Protein 1 (EGR1) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
GENTAUR-58be30b7b9d8c EGR1 (Zif268, Early Growth Response Protein 1, Krox-24, NGFI-A, TIS8, ZENK) 100ug 614 € MBS mono human
GENTAUR-58be30b82d28a EGR1 (Zif268, Early Growth Response Protein 1, Krox-24, NGFI-A, TIS8, ZENK) Antibody 100ug 614 € MBS mono human
MBS618924 EGR1 (Zif268, Early Growth Response Protein 1, Krox-24, NGFI-A, TIS8, ZENK) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS623144 EGR1 (Zif268, Early Growth Response Protein 1, Krox-24, NGFI-A, TIS8, ZENK) Antibody 100ug 917 € MBS Polyclonals_1 human
AE46013CH-48 ELISA test for Chicken Early growth response protein 1 (EGR1) 1x plate of 48 wells 402 € abebio chicken
DL-EGR1-Mu Mouse Early Growth Response Protein 1 EGR1 ELISA Kit 96T 869 € DL elisas mouse
KT-52217 Mouse Early Growth Response Protein 1 ELISA kit Kit (EGR1) 96 well plate 1074 € Kamiya mouse
GENTAUR-58bd10aa42750 Serinus canaria Early growth response protein 1 (EGR1) 100ug 1260 € MBS Recombinant Proteins human
GENTAUR-58bd10aa7c1f8 Serinus canaria Early growth response protein 1 (EGR1) 1000ug 1260 € MBS Recombinant Proteins human
GENTAUR-58bd10aac4cf3 Serinus canaria Early growth response protein 1 (EGR1) 100ug 1768 € MBS Recombinant Proteins human