| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight: |
2 kD, 30 |
| UniProt number: |
Q9H832-2 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
50 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM HEPES, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
UBE2Z (N-6His), Ubiquitin-Conjugating E2 Z |
| Short name: |
UBE2Z (N-6His), Recombinant Ubiquitin-Conjugating Enzyme E2 Z |
| Technique: |
E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Ubiquitin-Conjugating Enzyme E2 Z, ubiquitin-conjugating enzyme E2Z (N-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
LOC100138178 and IDBG-638867 and ENSBTAG00000018802 and 100138178, UBE2Z and IDBG-57321 and ENSG00000159202 and 65264, Ube2z and IDBG-209805 and ENSMUSG00000014349 and 268470, acid-amino acid ligase activity, nuclei, this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008152 and metabolic process and biological process this GO :0016567 and protein ubiquitination and biological process this GO :0016881 and acid-amino acid ligase activity and molecular function, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016881 : acid-amino acid ligase activity, this GO :0005524 : ATP binding, this GO :0016881 : acid-amino acid ligase activity, ubiquitin-conjugating enzyme E2Z |
| Identity: |
25847 |
| Gene: |
UBE2Z |
More about : UBE2Z |
| Long gene name: |
ubiquitin conjugating enzyme E2 Z |
| Synonyms gene name: |
ubiquitin-conjugating enzyme E2Z |
| Synonyms: |
FLJ13855 USE1 |
| Synonyms name: |
UBA6-specific enzyme E2 |
| Locus: |
17q21, 32 |
| Discovery year: |
2005-12-15 |
| GenBank acession: |
BC015890 |
| Entrez gene record: |
65264 |
| Pubmed identfication: |
17597759 |
| RefSeq identity: |
NM_023079 |
| Classification: |
Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT: |
OTTHUMG00000150521 |