Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)

Contact us
Catalog number: CG35
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His)
Quantity: 500 µg
Other quantities: 1 mg 1115€ 10 µg 100€ 50 µg 151€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 2 kD, 30
UniProt number: Q9H832-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 50 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBE2Z (N-6His), Ubiquitin-Conjugating E2 Z
Short name: UBE2Z (N-6His), Recombinant Ubiquitin-Conjugating Enzyme E2 Z
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Ubiquitin-Conjugating Enzyme E2 Z, ubiquitin-conjugating enzyme E2Z (N-6His), recombinant H
Alternative technique: rec
Alternative to gene target: LOC100138178 and IDBG-638867 and ENSBTAG00000018802 and 100138178, UBE2Z and IDBG-57321 and ENSG00000159202 and 65264, Ube2z and IDBG-209805 and ENSMUSG00000014349 and 268470, acid-amino acid ligase activity, nuclei, this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008152 and metabolic process and biological process this GO :0016567 and protein ubiquitination and biological process this GO :0016881 and acid-amino acid ligase activity and molecular function, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016881 : acid-amino acid ligase activity, this GO :0005524 : ATP binding, this GO :0016881 : acid-amino acid ligase activity, ubiquitin-conjugating enzyme E2Z
Identity: 25847
Gene: UBE2Z | More about : UBE2Z
Long gene name: ubiquitin conjugating enzyme E2 Z
Synonyms gene name: ubiquitin-conjugating enzyme E2Z
Synonyms: FLJ13855 USE1
Synonyms name: UBA6-specific enzyme E2
Locus: 17q21, 32
Discovery year: 2005-12-15
GenBank acession: BC015890
Entrez gene record: 65264
Pubmed identfication: 17597759
RefSeq identity: NM_023079
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000150521

Related Products :

MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
CG35 Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z, UBE2Z (N-6His) 50 µg 151 € novo human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS624307 UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) Antibody 100ug 658 € MBS Polyclonals_1 human
C183 Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His) 10 µg 80 € novo human
C862 Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His) 50 µg 369 € novo human
CG01 Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His) 50 µg 339 € novo human
CG45 Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag) 10 µg 80 € novo human
CG23 Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His) 50 µg 151 € novo human
C187 Recombinant Human Ubiquitin-Conjugating Enzyme E2 T, UBE2T (N-6His) 50 µg 126 € novo human
CG36 Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1, UBE2V1 (C-6His) 500 µg 405 € novo human
CG24 Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2, UBE2V2, DDVIT1 (N-6His) 500 µg 1613 € novo human
CG31 Recombinant Human Ubiquitin, ISG15-Conjugating Enzyme E2 L6, UBE2L6, , UbcH8 (C-6His) 10 µg 146 € novo human
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
GWB-P0020G Ubc9 (Human ubiquitin conjugating enzyme 9) Human, Recombinant Protein bulk Ask price € genways bulk human
RP-427 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 10 10 μg 260 € adi human
RP-426 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 12 10 μg 260 € adi human
RP-428 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 3 10 μg 260 € adi human
RP-425 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 7, His-tag 10 μg 260 € adi human
RP-421 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating Enzyme E2B 10 μg 260 € adi human
RP-424 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating Enzyme E2D3 10 μg 260 € adi human
RP-423 Recombinant (E.Coli) Human Ubiquitin Conjugating enzyme 7 10 μg 260 € adi human
RP-422 Recombinant (E.Coli) Human Ubiquitin Conjugating enzyme 9 10 μg 260 € adi human
RP-363 Recombinant (E.Coli) Human Ubiquitin Conjugating Enzyme 9, His-tag 10 μg 260 € adi human
CF58 Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B 500 µg 1613 € novo human