| Reacts with: |
Human |
| Source: |
Escherichia coli |
| Description: |
Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed |
| Molecular Weight: |
11, 3 kD |
| UniProt number: |
Q99584 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to ؕؕ_x005F_x0008_ ؖؖ_x005F_x0008_ ؗؗ_x005F_x0008_ , Always centrifuge tubes before opening, ep, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene target: |
S100A13, Protein S100-A13 |
| Short name: |
S100A13, Protein S100-A13 |
| Alternative name: |
S100 calcium binding protein A13, Protein S100-A13 |
| Alternative to gene target: |
RAGE receptor binding, S100A13 and IDBG-102736 and ENSG00000189171 and 6284, S100A13 and IDBG-632825 and ENSBTAG00000021378 and 404146, S100a13 and IDBG-167784 and ENSMUSG00000042312 and 20196, nuclei, this GO :0005507 and copper ion binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0008270 and zinc ion binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008289 and lipid binding and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0017134 and fibroblast growth factor binding and molecular function this GO :0042629 and mast cell granule and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043303 and mast cell degranulation and biological process this GO :0046688 and response to copper ion and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050663 and cytokine secretion and biological process this GO :0050703 and interleukin-1 alpha secretion and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0051602 and response to electrical stimulus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005507 : copper ion binding, this GO :0005507 : copper ion binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0008289 : lipid binding and also this GO :0017134 : fibroblast growth factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0050786 : RAGE receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0008289 : lipid binding, this GO :0017134 : fibroblast growth factor binding, this GO :0042803 : protein homodimerization activity, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A13 |
| Identity: |
10490 |
| Gene: |
S100A13 |
More about : S100A13 |
| Long gene name: |
S100 calcium binding protein A13 |
| Synonyms gene name: |
S100 calcium-binding protein A13 |
| Locus: |
1q21, 3 |
| Discovery year: |
1997-10-30 |
| GenBank acession: |
AK097132 |
| Entrez gene record: |
6284 |
| Pubmed identfication: |
8985590 |
| RefSeq identity: |
NM_005979 |
| Classification: |
S100 calcium binding proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000036641 |