Protein S100-A13, S100A13

Contact us
Catalog number: CG16
Price: 869 €
Supplier: DL elisas
Product name: Protein S100-A13, S100A13
Quantity: 96T
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: Escherichia coli
Description: Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed
Molecular Weight: 11, 3 kD
UniProt number: Q99584
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to ؕؕ_x005F_x0008_ ؖؖ_x005F_x0008_ ؗؗ_x005F_x0008_ , Always centrifuge tubes before opening, ep, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene target: S100A13, Protein S100-A13
Short name: S100A13, Protein S100-A13
Alternative name: S100 calcium binding protein A13, Protein S100-A13
Alternative to gene target: RAGE receptor binding, S100A13 and IDBG-102736 and ENSG00000189171 and 6284, S100A13 and IDBG-632825 and ENSBTAG00000021378 and 404146, S100a13 and IDBG-167784 and ENSMUSG00000042312 and 20196, nuclei, this GO :0005507 and copper ion binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0008270 and zinc ion binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008289 and lipid binding and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0017134 and fibroblast growth factor binding and molecular function this GO :0042629 and mast cell granule and cellular component this GO :0042803 and protein homodimerization activity and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043303 and mast cell degranulation and biological process this GO :0046688 and response to copper ion and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050663 and cytokine secretion and biological process this GO :0050703 and interleukin-1 alpha secretion and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0051602 and response to electrical stimulus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005507 : copper ion binding, this GO :0005507 : copper ion binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0008289 : lipid binding and also this GO :0017134 : fibroblast growth factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0050786 : RAGE receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0008289 : lipid binding, this GO :0017134 : fibroblast growth factor binding, this GO :0042803 : protein homodimerization activity, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A13
Identity: 10490
Gene: S100A13 | More about : S100A13
Long gene name: S100 calcium binding protein A13
Synonyms gene name: S100 calcium-binding protein A13
Locus: 1q21, 3
Discovery year: 1997-10-30
GenBank acession: AK097132
Entrez gene record: 6284
Pubmed identfication: 8985590
RefSeq identity: NM_005979
Classification: S100 calcium binding proteins
Havana BLAST/BLAT: OTTHUMG00000036641

Related Products :

GENTAUR-58bdc628b36ed Anti- S100 Calcium Binding Protein A13 (S100A13) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd07d56882 Anti- S100 Calcium Binding Protein A13 (S100A13) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd07dc2f36 Anti- S100 Calcium Binding Protein A13 (S100A13) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bddb4f7724c Anti- S100 Calcium Binding Protein A13 (S100A13) Antibody 100ug 564 € MBS Polyclonals human
CG16 Protein S100-A13, S100A13 1 mg 2283 € novo human
MBS617516 S100 Calcium Binding Protein A13 (S100A13) 100ug 774 € MBS Polyclonals_1 human
MBS611462 S100 Calcium Binding Protein A13 (S100A13) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS613298 CABP9K (CALB3, CABP1, S100G, S100 calcium binding protein G, CABP, Calbindin-D9k, MGC138379, Protein S100-G, S100 calcium-binding protein G, S100D, Vitamin D-dependent calcium-binding protein, intestinal) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
abx262638 Anti-S100 Calcium Binding Protein A13 Protein (Recombinant) 1 mg 6662 € abbex human
abx576375 Anti-Cow S100 Calcium Binding Protein (S100) ELISA Kit 96 tests 833 € abbex cow
MBS280005 Anti-Human S100 Calcium Binding Protein (S100) PAb 100ug 520 € MBS Polyclonals_1 human
abx573893 Anti-Rat S100 Calcium Binding Protein (S100) ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc70c34539 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc70c87593 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc89941793 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc9a524974 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdca0060279 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca00b1b60 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcad4a4f91 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdce44c50dc Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdce4535049 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf6a53607 Anti- S100 Calcium Binding Protein (S100) Antibody 50ug 348 € MBS Polyclonals human
GENTAUR-58bdcf6aaf0ff Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcf9f1f8c9 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd9d68f868 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddc7b7cc89 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddce0e1d57 Anti- S100 Calcium Binding Protein (S100) Antibody 100ug 531 € MBS Polyclonals human
DL-S100-b Bovine S100 Calcium Binding Protein S100 ELISA Kit 96T 962 € DL elisas bovine
DL-S100-Hu Human S100 Calcium Binding Protein S100 ELISA Kit 96T 846 € DL elisas human
DL-S100-Mu Mouse S100 Calcium Binding Protein S100 ELISA Kit 96T 869 € DL elisas mouse