| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Programmed Cell Death Protein 5 is produced by our E, coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
16, 4 kD |
| UniProt number: |
O14737 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TFAR19 (N-6His), PDCD5 |
| Short name: |
TFAR19 (N-6His), Recombinant PDCD5 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
TFAR19 (N-6His), sapiens programmed cellular death 5, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA binding, PDCD5 and IDBG-42196 and ENSG00000105185 and 9141, PDCD5 and IDBG-635019 and ENSBTAG00000009304 and 509123, Pdcd5 and IDBG-175016 and ENSMUSG00000030417 and 100042424, TFAR19, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding, 56330, programmed cell death 5 |
| Identity: |
8764 |
| Gene: |
PDCD5 |
More about : PDCD5 |
| Long gene name: |
programmed cell death 5 |
| Synonyms: |
TFAR19 MGC9294 |
| Synonyms name: |
TFAR19 novel apoptosis-related TF1 cell apoptosis-related gene 19 |
| Locus: |
19q13, 11 |
| Discovery year: |
1999-12-10 |
| GenBank acession: |
AF014955 |
| Entrez gene record: |
9141 |
| Pubmed identfication: |
9920759 |
| RefSeq identity: |
NM_004708 |
| Havana BLAST/BLAT: |
OTTHUMG00000180224 |