Recombinant Human PDCD5, TFAR19 (N-6His)

Contact us
Catalog number: CG07
Price: 732 €
Supplier: acr
Product name: Recombinant Human PDCD5, TFAR19 (N-6His)
Quantity: 50 Вµg
Other quantities: 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Programmed Cell Death Protein 5 is produced by our E, coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus
Molecular Weight: 16, 4 kD
UniProt number: O14737
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TFAR19 (N-6His), PDCD5
Short name: TFAR19 (N-6His), Recombinant PDCD5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TFAR19 (N-6His), sapiens programmed cellular death 5, recombinant H
Alternative technique: rec
Alternative to gene target: DNA binding, PDCD5 and IDBG-42196 and ENSG00000105185 and 9141, PDCD5 and IDBG-635019 and ENSBTAG00000009304 and 509123, Pdcd5 and IDBG-175016 and ENSMUSG00000030417 and 100042424, TFAR19, nuclei, this GO :0003677 and DNA binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006915 and apoptotic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding, 56330, programmed cell death 5
Identity: 8764
Gene: PDCD5 | More about : PDCD5
Long gene name: programmed cell death 5
Synonyms: TFAR19 MGC9294
Synonyms name: TFAR19 novel apoptosis-related TF1 cell apoptosis-related gene 19
Locus: 19q13, 11
Discovery year: 1999-12-10
GenBank acession: AF014955
Entrez gene record: 9141
Pubmed identfication: 9920759
RefSeq identity: NM_004708
Havana BLAST/BLAT: OTTHUMG00000180224

Related Products :

CG07 Recombinant Human PDCD5, TFAR19 (N-6His) 500 µg 1613 € novo human
GENTAUR-58be5d7e14c13 Anti-TFAR19/PDCD5 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-1333R-A350 TFAR19/PDCD5 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1333R-A488 TFAR19/PDCD5 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1333R-A555 TFAR19/PDCD5 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1333R-A594 TFAR19/PDCD5 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1333R-A647 TFAR19/PDCD5 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1333R-Biotin TFAR19/PDCD5 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1333R TFAR19/PDCD5 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1333R-Cy3 TFAR19/PDCD5 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1333R-Cy5 TFAR19/PDCD5 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1333R-Cy5.5 TFAR19/PDCD5 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1333R-Cy7 TFAR19/PDCD5 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1333R-FITC TFAR19/PDCD5 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1333R-HRP TFAR19/PDCD5 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GWB-P0095D PDCD5 , 1-125aa, Recombinant Protein bulk Ask price € genways bulk human
MBS244798 Anti-Human PDCD5 50ug 597 € MBS Polyclonals_1 human
abx152669 Anti-Human PDCD5 ELISA Kit inquire 50 € abbex human
abx573230 Anti-Human PDCD5 ELISA Kit 96 tests 847 € abbex human
GENTAUR-58bb5ccdce6ca Human Programmed cell death protein 5 (PDCD5) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bb5cce2cfc3 Human Programmed cell death protein 5 (PDCD5) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bb5cce6aa5d Human Programmed cell death protein 5 (PDCD5) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bb5cceb3ae6 Human Programmed cell death protein 5 (PDCD5) 1000ug 1934 € MBS Recombinant Proteins human
DL-PDCD5-Hu Human Programmed Cell Death Protein 5 PDCD5 ELISA Kit 96T 974 € DL elisas human
LV258055 PDCD5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09067PU-L anti-PDCD5 (1-125) Antibody 0,5 mg 1500 € acr human
AR09067PU-N anti-PDCD5 (1-125) Antibody 0,1 mg 587 € acr human
abx142130 Anti-PDCD5 Antibody 100 μl 383 € abbex human
abx217670 Anti-PDCD5 Antibody 200 μg 369 € abbex human
AP23124PU-N anti-PDCD5 (C-term) Antibody 50 Вµg 732 € acr human