| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Amphiregulin is produced by our E, coli expression system and the target gene encoding Ser101-Lys198 is expressed |
| Molecular Weight: |
11, 4 kD |
| UniProt number: |
P15514 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AREG, Amphiregulin |
| Short name: |
AREG, Recombinant Amphiregulin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
amphiregulin, sapiens Amphiregulin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AR and AREGB and CRDGF and SDGF, AREG and IDBG-24392 and ENSG00000109321 and 374, Areg and IDBG-179096 and ENSMUSG00000029378 and 11839, BT, growth factor activity, nuclei, this GO :0005125 and cytokine activity and molecular function this GO :0005154 and epidermal growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0014009 and glial cell proliferation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0031175 and neuron projection development and biological process this GO :0032355 and response to estradiol and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051591 and response to cAMP and biological process this GO :0060598 and dichotomous subdivision of terminal units involved in mammary gland duct morphogenesis and biological process this GO :0060744 and mammary gland branching involved in thelarche and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0060750 and epithelial cell proliferation involved in mammary gland duct elongation and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005154 : epidermal growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005154 : epidermal growth factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, 28934 and IDBG-643038 and ENSBTAG00000018134 and 538751, amphiregulin |
| Identity: |
651 |
| Gene: |
AREG |
More about : AREG |
| Long gene name: |
amphiregulin |
| Synonyms gene: |
SDGF AREGB |
| Synonyms gene name: |
schwannoma-derived growth factor amphiregulin B |
| Locus: |
4q13, 3 |
| Discovery year: |
1989-05-19 |
| GenBank acession: |
M30704 |
| Entrez gene record: |
374 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000130006 |