| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human N-Acetylneuraminate Synthase is produced by our E, coli expression system and the target gene encoding Met1-Ser359 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
4 kD, 42 |
| UniProt number: |
Q9NR45 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
NANS, SAS (N-6His), N-Acetylneuraminate Synthase |
| Short name: |
NANS, SAS (N-6His), Recombinant N-Acetylneuraminate Synthase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
N-acetylneuraminic acid synthase, SAS (N-6His), sapiens N-Acetylneuraminate Synthase, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, N-acetylneuraminate synthase activity, NANS and IDBG-634017 and ENSBTAG00000019023 and 540602, NANS and IDBG-78125 and ENSG00000095380 and 54187, Nans and IDBG-145321 and ENSMUSG00000028334 and 94181, this GO :0003824 and catalytic activity and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0008781 and N-acylneuraminate cytidylyltransferase activity and molecular function this GO :0009103 and lipopolysaccharide biosynthetic process and biological process this GO :0016051 and carbohydrate biosynthetic process and biological process this GO :0047444 and N-acylneuraminate-9-phosphate synthase activity and molecular function this GO :0050462 and N-acetylneuraminate synthase activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0008781 : N-acylneuraminate cytidylyltransferase activity and also this GO :0047444 : N-acylneuraminate-9-phosphate synthase activity and also this GO :0050462 : N-acetylneuraminate synthase activity, this GO :0008781 : N-acylneuraminate cytidylyltransferase activity, this GO :0047444 : N-acylneuraminate-9-phosphate synthase activity, this GO :0050462 : N-acetylneuraminate synthase activity, N-acetylneuraminic acid synthase |
| Identity: |
19237 |
| Gene: |
NANS |
More about : NANS |
| Long gene name: |
N-acetylneuraminate synthase |
| Synonyms gene name: |
N-acetylneuraminic acid synthase |
| Synonyms: |
SAS |
| Synonyms name: |
sialic acid synthase |
| Locus: |
9q22, 33 |
| Discovery year: |
2002-12-16 |
| GenBank acession: |
AF161387 |
| Entrez gene record: |
54187 |
| Pubmed identfication: |
10749855 27213289 |
| RefSeq identity: |
NM_018946 |
| Havana BLAST/BLAT: |
OTTHUMG00000020341 |