Recombinant Human N-Acetylneuraminate Synthase, NANS, SAS (N-6His)

Contact us
Catalog number: CF98
Price: 521 €
Supplier: genways
Product name: Recombinant Human N-Acetylneuraminate Synthase, NANS, SAS (N-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human N-Acetylneuraminate Synthase is produced by our E, coli expression system and the target gene encoding Met1-Ser359 is expressed with a 6His tag at the N-terminus
Molecular Weight: 4 kD, 42
UniProt number: Q9NR45
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NANS, SAS (N-6His), N-Acetylneuraminate Synthase
Short name: NANS, SAS (N-6His), Recombinant N-Acetylneuraminate Synthase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: N-acetylneuraminic acid synthase, SAS (N-6His), sapiens N-Acetylneuraminate Synthase, recombinant H
Alternative technique: rec
Alternative to gene target: Cytoplasm, N-acetylneuraminate synthase activity, NANS and IDBG-634017 and ENSBTAG00000019023 and 540602, NANS and IDBG-78125 and ENSG00000095380 and 54187, Nans and IDBG-145321 and ENSMUSG00000028334 and 94181, this GO :0003824 and catalytic activity and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0008781 and N-acylneuraminate cytidylyltransferase activity and molecular function this GO :0009103 and lipopolysaccharide biosynthetic process and biological process this GO :0016051 and carbohydrate biosynthetic process and biological process this GO :0047444 and N-acylneuraminate-9-phosphate synthase activity and molecular function this GO :0050462 and N-acetylneuraminate synthase activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0008781 : N-acylneuraminate cytidylyltransferase activity and also this GO :0047444 : N-acylneuraminate-9-phosphate synthase activity and also this GO :0050462 : N-acetylneuraminate synthase activity, this GO :0008781 : N-acylneuraminate cytidylyltransferase activity, this GO :0047444 : N-acylneuraminate-9-phosphate synthase activity, this GO :0050462 : N-acetylneuraminate synthase activity, N-acetylneuraminic acid synthase
Identity: 19237
Gene: NANS | More about : NANS
Long gene name: N-acetylneuraminate synthase
Synonyms gene name: N-acetylneuraminic acid synthase
Synonyms: SAS
Synonyms name: sialic acid synthase
Locus: 9q22, 33
Discovery year: 2002-12-16
GenBank acession: AF161387
Entrez gene record: 54187
Pubmed identfication: 10749855 27213289
RefSeq identity: NM_018946
Havana BLAST/BLAT: OTTHUMG00000020341

Related Products :

CF98 Recombinant Human N-Acetylneuraminate Synthase, NANS, SAS (N-6His) 1 mg 2283 € novo human
MBS619027 Spindle Assembly Abnormal Protein 6 (Spindle Assembly Abnormal Protein 6 Homolog, SASS6, Spindle Assembly 6 Homolog (C. elegans), SAS 6, SAS6, SAS-6, FLJ22097, HsSAS 6, HsSAS-6, MGC119440) Antibody 100ul 785 € MBS Polyclonals_1 human
AE81013SF-48 ELISA test for Sulfonamides residues (SAs) 1x plate of 48 wells 305 € abebio human
GENTAUR-58bd79de13548 Spindle assembly abnormal protein 5 (sas-5) 100ug 2133 € MBS Recombinant Proteins human
GENTAUR-58bd79de60cba Spindle assembly abnormal protein 5 (sas-5) 1000ug 2133 € MBS Recombinant Proteins human
GENTAUR-58bd79deb1102 Spindle assembly abnormal protein 5 (sas-5) 100ug 2647 € MBS Recombinant Proteins human
GENTAUR-58bd79df0b3ac Spindle assembly abnormal protein 5 (sas-5) 1000ug 2647 € MBS Recombinant Proteins human
AE81013SF-96 Sulfonamides residues (SAs) ELISA Kit 1x plate of 96 wells 478 € abebio human
DE-100090-RDT TruStrip RDT Sulfonamides residues (SAs) rapid test strips, results is 2-10 mins, 50 strips/pk 1 pk Ask price € adi human
GWB-P1254F NANS, 1-359aa, Recombinant Protein bulk Ask price € genways bulk human
DL-NANS-Hu Human N-Acetylneuraminic Acid Synthase NANS ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdaf874ff3c Human Sialic acid synthase (NANS) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bdaf87b0b5b Human Sialic acid synthase (NANS) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bdaf885c588 Human Sialic acid synthase (NANS) 100ug 2531 € MBS Recombinant Proteins human
GENTAUR-58bdaf88dc6ea Human Sialic acid synthase (NANS) 1000ug 2531 € MBS Recombinant Proteins human
EKU06134 N-Acetylneuraminic Acid Synthase (NANS) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx152453 Anti-Human NANS ELISA Kit 96 tests 934 € abbex human
abx571221 Anti-Human NANS ELISA Kit inquire 50 € abbex human
GENTAUR-58bde86be570a Mouse Monoclonal [clone AT1G6] (IgG1,k) to Human NANS Antibody 0.05 ml 597 € MBS mono human
GWB-BSP253 NANS Human Protein bulk Ask price € genways bulk human
AR09723PU-L anti-NANS (1-359, His-tag) Antibody 0,5 mg 1138 € acr human
AR09723PU-N anti-NANS (1-359, His-tag) Antibody 0,1 mg 485 € acr human
AM09398PU-N anti-NANS Antibody 0,1 ml 500 € acr human
AM09398PU-S anti-NANS Antibody 50 Вµl 384 € acr human
GENTAUR-58be4199b6e5b Anti- NANS Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be533948c51 Anti- NANS Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be533995521 Anti- NANS Antibody 50ug 365 € MBS Polyclonals human
abx925387 Anti-NANS siRNA 30 nmol 717 € abbex human
GWB-MX334A NANS antibody 1 vial 521 € genways human
GWB-MX335B NANS antibody 1 vial 521 € genways human