Recombinant Human BNIP3, NIP3 (N-6His)

Contact us
Catalog number: CF87
Price: 427 €
Supplier: abbex
Product name: Recombinant Human BNIP3, NIP3 (N-6His)
Quantity: 200 ul
Other quantities: 1 mg 2486€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human BNIP3 is produced by our E, coli expression system and the target gene encoding Met1-Leu166 is expressed with a 6His tag at the N-terminus
Molecular Weight: 20, 6 kD
UniProt number: Q12983
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NIP3 (N-6His), BNIP3
Short name: NIP3 (N-6His), Recombinant BNIP3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NIP3 (N-6His), sapiens B-cell CLL/lymphoma 2/adenovirus E1B 19kDa interacting protein 3, recombinant H
Alternative technique: rec
Alternative to gene target: BNIP3 and IDBG-641206 and ENSBTAG00000017804 and 615342, BNIP3 and IDBG-93314 and ENSG00000176171 and 664, Bnip3 and IDBG-269444 and ENSMUSG00000078566 and 12176, GTPase binding, NIP3, nuclei, this GO :0001666 and response to hypoxia and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005635 and nuclear envelope and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005740 and mitochondrial envelope and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008219 and cell death and biological process this GO :0008626 and granzyme-mediated apoptotic signaling pathway and biological process this GO :0010508 and positive regulation of autophagy and biological process this GO :0010637 and negative regulation of mitochondrial fusion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030425 and dendrite and cellular component this GO :0031307 and integral component of mitochondrial outer membrane and cellular component this GO :0031966 and mitochondrial membrane and cellular component this GO :0035694 and mitochondrial protein catabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0045837 and negative regulation of membrane potential and biological process this GO :0046902 and regulation of mitochondrial membrane permeability and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048102 and autophagic cell death and biological process this GO :0050873 and brown fat cell differentiation and biological process this GO :0051020 and GTPase binding and molecular function this GO :0051402 and neuron apoptotic process and biological process this GO :0051607 and defense response to virus and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071279 and cellular response to cobalt ion and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process this GO :0090141 and positive regulation of mitochondrial fission and biological process this GO :0090200 and positive regulation of release of cytochrome c from mitochondria and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :0097345 and mitochondrial outer membrane permeabilization and biological process this GO :1990144 and intrinsic apoptotic signaling pathway in response to hypoxia and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0051020 : GTPase binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0051020 : GTPase binding, BCL2/adenovirus E1B 19kDa interacting protein 3
Identity: 1084
Gene: BNIP3 | More about : BNIP3
Long gene name: BCL2 interacting protein 3
Synonyms gene name: BCL2/adenovirus E1B 19kDa interacting protein 3
Synonyms: Nip3
Locus: 10q26, 3
Discovery year: 1997-03-19
GenBank acession: U15174
Entrez gene record: 664
Pubmed identfication: 7954800
Classification: BCL2 homology region 3 (BH3) only
Havana BLAST/BLAT: OTTHUMG00000019278

Related Products :

CF87 Recombinant Human BNIP3, NIP3 (N-6His) 10 µg 202 € novo human
MBS611920 BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3) 100ug 774 € MBS Polyclonals_1 human
MBS610584 BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS613003 BNIP3 (Bcl2/Adenovirus E1B 19kD Protein-Interacting Protein 3, 19kD Interacting Protein 3, NIP3) Antibody 100ul 597 € MBS Polyclonals_1 human
GWB-BBP078 Polyclonal antibody to or anti-NIP3/BNIP3 antibody 1 vial 463 € genways human
AP20658PU-N anti-NIP3 Antibody 0,1 mg 558 € acr human
BB-PA1057 anti-NIP3 Antibody 0,1 mg 471 € acr human
CPA1105-100ul anti-NIP3 Antibody 0,1 ml 442 € acr human
CPA1105-200ul anti-NIP3 Antibody 0,2 ml 688 € acr human
CPA1105-30ul anti-NIP3 Antibody 30 Вµl 326 € acr human
AP11311PU-N anti-NIP3 (BH3 Domain) Antibody 0,4 ml 587 € acr human
AP23270PU-N anti-NIP3 (C-term) Antibody 0,1 mg 543 € acr human
LV090118 BNIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV090119 BNIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV090120 BNIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV090121 BNIP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV090123 BNIP3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV090122 BNIP3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdefac805d1 Anti- BNIP3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdefad35e7d Anti- BNIP3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf02cc08b5 Anti- BNIP3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf02d35ded Anti- BNIP3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0ab176ba0 Anti- BNIP3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0ab1edf1a Anti- BNIP3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be413a7b8a4 Anti- BNIP3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be470f8bed3 Anti- BNIP3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be56e1b5962 Anti- BNIP3 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be56e1f1b57 Anti- BNIP3 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be56e249b4c Anti- BNIP3 Antibody 100ug 387 € MBS Polyclonals human
abx133540 Anti-BNIP3 Antibody 200 ul 427 € abbex human