| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human BNIP3 is produced by our E, coli expression system and the target gene encoding Met1-Leu166 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
20, 6 kD |
| UniProt number: |
Q12983 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
NIP3 (N-6His), BNIP3 |
| Short name: |
NIP3 (N-6His), Recombinant BNIP3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
NIP3 (N-6His), sapiens B-cell CLL/lymphoma 2/adenovirus E1B 19kDa interacting protein 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BNIP3 and IDBG-641206 and ENSBTAG00000017804 and 615342, BNIP3 and IDBG-93314 and ENSG00000176171 and 664, Bnip3 and IDBG-269444 and ENSMUSG00000078566 and 12176, GTPase binding, NIP3, nuclei, this GO :0001666 and response to hypoxia and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005635 and nuclear envelope and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005740 and mitochondrial envelope and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008219 and cell death and biological process this GO :0008626 and granzyme-mediated apoptotic signaling pathway and biological process this GO :0010508 and positive regulation of autophagy and biological process this GO :0010637 and negative regulation of mitochondrial fusion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030425 and dendrite and cellular component this GO :0031307 and integral component of mitochondrial outer membrane and cellular component this GO :0031966 and mitochondrial membrane and cellular component this GO :0035694 and mitochondrial protein catabolic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0045837 and negative regulation of membrane potential and biological process this GO :0046902 and regulation of mitochondrial membrane permeability and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048102 and autophagic cell death and biological process this GO :0050873 and brown fat cell differentiation and biological process this GO :0051020 and GTPase binding and molecular function this GO :0051402 and neuron apoptotic process and biological process this GO :0051607 and defense response to virus and biological process this GO :0055093 and response to hyperoxia and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071279 and cellular response to cobalt ion and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process this GO :0090141 and positive regulation of mitochondrial fission and biological process this GO :0090200 and positive regulation of release of cytochrome c from mitochondria and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :0097345 and mitochondrial outer membrane permeabilization and biological process this GO :1990144 and intrinsic apoptotic signaling pathway in response to hypoxia and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0051020 : GTPase binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0051020 : GTPase binding, BCL2/adenovirus E1B 19kDa interacting protein 3 |
| Identity: |
1084 |
| Gene: |
BNIP3 |
More about : BNIP3 |
| Long gene name: |
BCL2 interacting protein 3 |
| Synonyms gene name: |
BCL2/adenovirus E1B 19kDa interacting protein 3 |
| Synonyms: |
Nip3 |
| Locus: |
10q26, 3 |
| Discovery year: |
1997-03-19 |
| GenBank acession: |
U15174 |
| Entrez gene record: |
664 |
| Pubmed identfication: |
7954800 |
| Classification: |
BCL2 homology region 3 (BH3) only |
| Havana BLAST/BLAT: |
OTTHUMG00000019278 |