| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ETS1 is produced by our E, coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
33 kD |
| UniProt number: |
Q96AC5 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride，1 mM EDTA, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
EWSR2, P54 (N-6His), ETS1 |
| Short name: |
EWSR2, P54 (N-6His), Recombinant ETS1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
EWSR2, P54 (N-6His), sapiens v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007565 and female pregnancy and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009611 and response to wounding and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010715 and regulation of extracellular matrix disassembly and biological process this GO :0021854 and hypothalamus development and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030578 and PML body organization and biological process this GO :0032355 and response to estradiol and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0035035 and histone acetyltransferase binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045171 and intercellular bridge and cellular component this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046677 and response to antibiotic and biological process this GO :0048870 and cell motility and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0060055 and angiogenesis involved in wound healing and biological process this GO :0060206 and estrous cycle phase and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0070555 and response to interleukin-1 and biological process, ETS-1 and EWSR2 and p54, ETS1 and IDBG-642787 and ENSBTAG00000002341 and 540313, ETS1 and IDBG-75897 and ENSG00000134954 and 2113, Ets1 and IDBG-147548 and ENSMUSG00000032035 and 23871, nuclei, sequence-specific DNA binding, this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0001666 and response to hypoxia and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006355 and regulation of transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0035035 : histone acetyltransferase binding and also this GO :0043565 : sequence-specific DNA binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0035035 : histone acetyltransferase binding, this GO :0043565 : sequence-specific DNA binding, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
| Identity: |
3749 |
| Gene: |
FLI1 |
More about : FLI1 |
| Long gene name: |
ETS transcription factor , Fli-1 proto-oncogene |
| Synonyms gene name: |
Friend leukemia virus integration 1 |
| Synonyms: |
SIC-1 EWSR2 |
| Locus: |
11q24, 3 |
| Discovery year: |
1991-06-05 |
| GenBank acession: |
M98833 |
| Entrez gene record: |
2313 |
| Pubmed identfication: |
1765382 |
| RefSeq identity: |
NM_002017 |
| Classification: |
ETS transcription factor family |
| Havana BLAST/BLAT: |
OTTHUMG00000165792 |
| Locus Specific Databases: |
LRG_646 |