Recombinant Human ETS1, EWSR2, P54 (N-6His)

Contact us
Catalog number: CF51
Price: 558 €
Supplier: acr
Product name: Recombinant Human ETS1, EWSR2, P54 (N-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ETS1 is produced by our E, coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus
Molecular Weight: 33 kD
UniProt number: Q96AC5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride,1 mM EDTA, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EWSR2, P54 (N-6His), ETS1
Short name: EWSR2, P54 (N-6His), Recombinant ETS1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EWSR2, P54 (N-6His), sapiens v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007565 and female pregnancy and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009611 and response to wounding and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010715 and regulation of extracellular matrix disassembly and biological process this GO :0021854 and hypothalamus development and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030578 and PML body organization and biological process this GO :0032355 and response to estradiol and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0035035 and histone acetyltransferase binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045171 and intercellular bridge and cellular component this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046677 and response to antibiotic and biological process this GO :0048870 and cell motility and biological process this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0060055 and angiogenesis involved in wound healing and biological process this GO :0060206 and estrous cycle phase and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0070555 and response to interleukin-1 and biological process, ETS-1 and EWSR2 and p54, ETS1 and IDBG-642787 and ENSBTAG00000002341 and 540313, ETS1 and IDBG-75897 and ENSG00000134954 and 2113, Ets1 and IDBG-147548 and ENSMUSG00000032035 and 23871, nuclei, sequence-specific DNA binding, this GO :0000981 and sequence-specific DNA binding RNA polymerase II transcription factor activity and molecular function this GO :0001666 and response to hypoxia and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006355 and regulation of transcription, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity, this GO :0000981 : sequence-specific DNA binding RNA polymerase II transcription factor activity and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008134 : transcription factor binding and also this GO :0035035 : histone acetyltransferase binding and also this GO :0043565 : sequence-specific DNA binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008134 : transcription factor binding, this GO :0035035 : histone acetyltransferase binding, this GO :0043565 : sequence-specific DNA binding, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Identity: 3749
Gene: FLI1 | More about : FLI1
Long gene name: ETS transcription factor , Fli-1 proto-oncogene
Synonyms gene name: Friend leukemia virus integration 1
Synonyms: SIC-1 EWSR2
Locus: 11q24, 3
Discovery year: 1991-06-05
GenBank acession: M98833
Entrez gene record: 2313
Pubmed identfication: 1765382
RefSeq identity: NM_002017
Classification: ETS transcription factor family
Havana BLAST/BLAT: OTTHUMG00000165792
Locus Specific Databases: LRG_646

Related Products :

CF51 Recombinant Human ETS1, EWSR2, P54 (N-6His) 1 mg 2486 € novo human
MBS610008 c-ets 1 (ETS1, ETS-1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), EWSR2) Antibody 200ul 514 € MBS Polyclonals_1 human
YSGSRA1600 FKBP54, p54, Clone: FF1, Mouse Monoclonal antibody-Human, Rabbit, Chicken 0.2mg Ask price € accurate-monoclonals chicken
YSGSRA1600-5 FKBP54, p54, Clone: FF1, Mouse Monoclonal antibody-Human, Rabbit, Chicken 50 ug Ask price € accurate-monoclonals chicken
GENTAUR-58bab1b383c9b African swine fever virus Envelope protein p54 (Pret-138) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bab1b4228bc African swine fever virus Envelope protein p54 (Pret-138) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b9d553da4b5 African swine fever virus Envelope protein p54 (War-136) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58b9d55454e8f African swine fever virus Envelope protein p54 (War-136) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58be3f1d13b8f Anti- P54 Antibody 100ug 393 € MBS Polyclonals human
MBS624510 CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623542 CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58bd208c9d7dc Enterococcus faecium Protein P54 100ug 2354 € MBS Recombinant Proteins human
GENTAUR-58bd208ced49f Enterococcus faecium Protein P54 1000ug 2354 € MBS Recombinant Proteins human
GENTAUR-58bd208d402f6 Enterococcus faecium Protein P54 100ug 2868 € MBS Recombinant Proteins human
GENTAUR-58bd208d72b04 Enterococcus faecium Protein P54 1000ug 2868 € MBS Recombinant Proteins human
MBS273757 p54/nrb antibody 100ul 426 € MBS Polyclonals_1 human
MBS616012 SAPKa (SAPK-alpha, SAPK, c-Jun N-terminal Kinase 2, JNK2, Mitogen-activated Protein Kinase 9, MAP Kinase 9, MAPK 9, MAPK9, PRKM9, p54-alpha, Stress-activated Protein Kinase JNK2) Antibody 0.025 ml 376 € MBS Polyclonals_1 human
LV150932 ETS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV150933 ETS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV150934 ETS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV150935 ETS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV150936 ETS1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
MBS246735 Goat Polyclonal to Human ETS1 / ETS-1 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-ASC177 Human ETS1 (Ab-38) Antibody bulk Ask price € genways bulk human
GWB-ASB146 Human ETS1 (Phospho-Thr38) Antibody bulk Ask price € genways bulk human
GENTAUR-58bde67b479ca Mouse Monoclonal [clone 8A8] (IgG1) to Human ETS1 / ETS-1 Antibody 0.05 ml 597 € MBS mono human
AP23985PU-N anti-ETS1 (127-138) Antibody 50 Вµg 732 € acr human
AM06415SU-N anti-ETS1 Antibody 0,1 ml 630 € acr human
AM06416SU-N anti-ETS1 Antibody 0,1 ml 630 € acr human
AP06524PU-N anti-ETS1 Antibody 0,1 mg 558 € acr human