| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Mitochondrial Fission 1 Protein is produced by our E, coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 2 kD |
| UniProt number: |
Q9Y3D6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FIS1 (C-6His), Mitochondrial Fission 1 Protein |
| Short name: |
FIS1 (C-6His), Recombinant Mitochondrial Fission 1 Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cerevisiae) (C-6His), fission 1 (mitochondrial outer membrane) homolog (S, sapiens Mitochondrial Fission 1 Protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
FIS1 and IDBG-234267 and ENSG00000214253 and 51024, FIS1 and IDBG-640356 and ENSBTAG00000007900 and 615565, Fis1 and IDBG-204681 and ENSMUSG00000019054 and 66437, Plasma membranes, cerevisiae), protein binding, this GO :0000266 and mitochondrial fission and biological process this GO :0000422 and mitochondrion degradation and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005779 and integral component of peroxisomal membrane and cellular component this GO :0006626 and protein targeting to mitochondrion and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008053 and mitochondrial fusion and biological process this GO :0010821 and regulation of mitochondrion organization and biological process this GO :0016020 and membrane and cellular component this GO :0016559 and peroxisome fission and biological process this GO :0031307 and integral component of mitochondrial outer membrane and cellular component this GO :0032471 and negative regulation of endoplasmic reticulum calcium ion concentration and biological process this GO :0035584 and calcium-mediated signaling using intracellular calcium source and biological process this GO :0043234 and protein complex and cellular component this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051561 and positive regulation of mitochondrial calcium ion concentration and biological process this GO :0070584 and mitochondrion morphogenesis and biological process this GO :0090141 and positive regulation of mitochondrial fission and biological process this GO :0090314 and positive regulation of protein targeting to membrane and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, fission 1 (mitochondrial outer membrane) homolog (S |
| Identity: |
21689 |
| Gene: |
FIS1 |
More about : FIS1 |
| Long gene name: |
fission, mitochondrial 1 |
| Synonyms gene: |
TTC11 |
| Synonyms gene name: |
cerevisiae) , tetratricopeptide repeat domain 11 fission 1 (mitochondrial outer membrane) homolog (yeast) fission 1 (mitochondrial outer membrane) homolog (S |
| Synonyms: |
CGI-135 H_NH0132A01, 6 Fis1 |
| Synonyms name: |
CGI-135 protein mitochondrial fission molecule |
| Locus: |
7q22, 1 |
| Discovery year: |
2003-07-09 |
| GenBank acession: |
AF151893 |
| Entrez gene record: |
51024 |
| Pubmed identfication: |
14996942 16010987 |
| RefSeq identity: |
NM_016068 |
| Classification: |
Tetratricopeptide repeat domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000157106 |