Recombinant Human Mitochondrial Fission 1 Protein, FIS1 (C-6His)

Contact us
Catalog number: CF28
Price: 1978 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Mitochondrial Fission 1 Protein, FIS1 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Mitochondrial Fission 1 Protein is produced by our E, coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 2 kD
UniProt number: Q9Y3D6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FIS1 (C-6His), Mitochondrial Fission 1 Protein
Short name: FIS1 (C-6His), Recombinant Mitochondrial Fission 1 Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cerevisiae) (C-6His), fission 1 (mitochondrial outer membrane) homolog (S, sapiens Mitochondrial Fission 1 Protein, recombinant H
Alternative technique: rec
Alternative to gene target: FIS1 and IDBG-234267 and ENSG00000214253 and 51024, FIS1 and IDBG-640356 and ENSBTAG00000007900 and 615565, Fis1 and IDBG-204681 and ENSMUSG00000019054 and 66437, Plasma membranes, cerevisiae), protein binding, this GO :0000266 and mitochondrial fission and biological process this GO :0000422 and mitochondrion degradation and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005739 and mitochondrion and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005779 and integral component of peroxisomal membrane and cellular component this GO :0006626 and protein targeting to mitochondrion and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008053 and mitochondrial fusion and biological process this GO :0010821 and regulation of mitochondrion organization and biological process this GO :0016020 and membrane and cellular component this GO :0016559 and peroxisome fission and biological process this GO :0031307 and integral component of mitochondrial outer membrane and cellular component this GO :0032471 and negative regulation of endoplasmic reticulum calcium ion concentration and biological process this GO :0035584 and calcium-mediated signaling using intracellular calcium source and biological process this GO :0043234 and protein complex and cellular component this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051561 and positive regulation of mitochondrial calcium ion concentration and biological process this GO :0070584 and mitochondrion morphogenesis and biological process this GO :0090141 and positive regulation of mitochondrial fission and biological process this GO :0090314 and positive regulation of protein targeting to membrane and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, fission 1 (mitochondrial outer membrane) homolog (S
Identity: 21689
Gene: FIS1 | More about : FIS1
Long gene name: fission, mitochondrial 1
Synonyms gene: TTC11
Synonyms gene name: cerevisiae) , tetratricopeptide repeat domain 11 fission 1 (mitochondrial outer membrane) homolog (yeast) fission 1 (mitochondrial outer membrane) homolog (S
Synonyms: CGI-135 H_NH0132A01, 6 Fis1
Synonyms name: CGI-135 protein mitochondrial fission molecule
Locus: 7q22, 1
Discovery year: 2003-07-09
GenBank acession: AF151893
Entrez gene record: 51024
Pubmed identfication: 14996942 16010987
RefSeq identity: NM_016068
Classification: Tetratricopeptide repeat domain containing
Havana BLAST/BLAT: OTTHUMG00000157106

Related Products :

CF28 Recombinant Human Mitochondrial Fission 1 Protein, FIS1 (C-6His) 50 µg 339 € novo human
abx572835 Anti-Human Fission 1 (FIS1) ELISA Kit 96 tests 789 € abbex human
DL-FIS1-Hu Human Fission 1 FIS1 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bd9e3fb404b Candida glabrata Mitochondria fission 1 protein (FIS1) 100ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd9e402e110 Candida glabrata Mitochondria fission 1 protein (FIS1) 1000ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bd9e4090395 Candida glabrata Mitochondria fission 1 protein (FIS1) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bd9e40dae02 Candida glabrata Mitochondria fission 1 protein (FIS1) 1000ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bd12ed41db4 Cryptococcus neoformans var. neoformans serotype D Mitochondria fission 1 protein (FIS1) 100ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bd12ed8f95d Cryptococcus neoformans var. neoformans serotype D Mitochondria fission 1 protein (FIS1) 1000ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bd12edd9911 Cryptococcus neoformans var. neoformans serotype D Mitochondria fission 1 protein (FIS1) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bd12ee35ece Cryptococcus neoformans var. neoformans serotype D Mitochondria fission 1 protein (FIS1) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bd718150f3e Emericella nidulans Mitochondria fission 1 protein (fis1) 100ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bd71818baec Emericella nidulans Mitochondria fission 1 protein (fis1) 1000ug 1437 € MBS Recombinant Proteins human
GENTAUR-58bd7181d9bab Emericella nidulans Mitochondria fission 1 protein (fis1) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bd718229222 Emericella nidulans Mitochondria fission 1 protein (fis1) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58bd7ba418b9d Neosartorya fumigata Mitochondria fission 1 protein (fis1) 100ug 1426 € MBS Recombinant Proteins human
GENTAUR-58bd7ba485dee Neosartorya fumigata Mitochondria fission 1 protein (fis1) 1000ug 1426 € MBS Recombinant Proteins human
GENTAUR-58bd7ba4e7814 Neosartorya fumigata Mitochondria fission 1 protein (fis1) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bd7ba541aa1 Neosartorya fumigata Mitochondria fission 1 protein (fis1) 1000ug 1929 € MBS Recombinant Proteins human
GENTAUR-58b9c6cf65373 Saccharomyces cerevisiae Mitochondria fission 1 protein (FIS1) 100ug 1448 € MBS Recombinant Proteins human
GENTAUR-58b9c6cfd0402 Saccharomyces cerevisiae Mitochondria fission 1 protein (FIS1) 1000ug 1448 € MBS Recombinant Proteins human
GENTAUR-58b9c6d01fa4a Saccharomyces cerevisiae Mitochondria fission 1 protein (FIS1) 100ug 1951 € MBS Recombinant Proteins human
GENTAUR-58b9c6d0822b6 Saccharomyces cerevisiae Mitochondria fission 1 protein (FIS1) 1000ug 1951 € MBS Recombinant Proteins human
EKU04227 Fission 1 (FIS1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GENTAUR-58bd909c2df08 Human Mitochondrial fission regulator 1 (MTFR1) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58bd909c91519 Human Mitochondrial fission regulator 1 (MTFR1) 1000ug 1835 € MBS Recombinant Proteins human
GENTAUR-58bd909cd3c5f Human Mitochondrial fission regulator 1 (MTFR1) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58bd909d29ff9 Human Mitochondrial fission regulator 1 (MTFR1) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58bcfa7f2a6c7 Mitochondrial fission process protein 1 (mtp-18) 1000ug 1470 € MBS Recombinant Proteins human
GENTAUR-58bcfa7f79e34 Mitochondrial fission process protein 1 (mtp-18) 1000ug 1978 € MBS Recombinant Proteins human