| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Serum Amyloid A4 Protein is produced by our E, coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
14 kD |
| UniProt number: |
P35542 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
0, 20% Glycerol, 200 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, 5 mM EDTA, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKYLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
Sera, recombinants |
| Gene target: |
SAA4 (C-6His), Amyloid A4 |
| Short name: |
SAA4 (C-6His), Recombinant Serum Amyloid A4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
constitutive (C-6His), sapiens blood serum Amyloid A4, serum amyloid A4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, SAA4 and IDBG-34611 and ENSG00000148965 and 6291, SAA4 and IDBG-642485 and ENSBTAG00000002963 and 505308, Saa4 and IDBG-186368 and ENSMUSG00000040017 and 20211, constitutive, this GO :0005576 and extracellular region and cellular component this GO :0006953 and acute-phase response and biological process this GO :0034364 and high-density lipoprotein particle and cellular component, serum amyloid A4 |
| Identity: |
10516 |
| Gene: |
SAA4 |
More about : SAA4 |
| Long gene name: |
constitutive , serum amyloid A4 |
| Synonyms: |
C-SAA CSAA |
| Locus: |
11p15, 1 |
| Discovery year: |
1992-06-12 |
| GenBank acession: |
M81349 |
| Entrez gene record: |
6291 |
| Pubmed identfication: |
8325654 |
| RefSeq identity: |
NM_006512 |
| Havana BLAST/BLAT: |
OTTHUMG00000166483 |