| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Serum Amyloid A1 Protein is produced by our E, coli expression system and the target gene encoding Arg19-Tyr122 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
13, 2 kD |
| UniProt number: |
P0DJI8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 8, 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
Sera, recombinants |
| Gene target: |
SAA1 (N-6His), Amyloid A1 |
| Short name: |
SAA1 (N-6His), Recombinant Serum Amyloid A1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens blood serum Amyloid A1, serum amyloid A1 (N-6His), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, PIG4 and SAA and SAA2 and TP53I4, SAA1 and IDBG-34659 and ENSG00000173432 and 6288, heparin binding, this GO :0001664 and G-protein coupled receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0006953 and acute-phase response and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008201 and heparin binding and molecular function this GO :0030168 and platelet activation and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0034364 and high-density lipoprotein particle and cellular component this GO :0045087 and innate immune response and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050716 and positive regulation of interleukin-1 secretion and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071682 and endocytic vesicle lumen and cellular component, this GO :0001664 : G-protein coupled receptor binding, this GO :0001664 : G-protein coupled receptor binding and also this GO :0008201 : heparin binding, this GO :0008201 : heparin binding, serum amyloid A1 |
| Identity: |
10513 |
| Gene: |
SAA1 |
More about : SAA1 |
| Long gene name: |
serum amyloid A1 |
| Synonyms gene: |
SAA |
| Synonyms: |
PIG4 TP53I4 |
| Locus: |
11p15, 1 |
| Discovery year: |
1988-01-18 |
| GenBank acession: |
M10906 |
| Entrez gene record: |
6288 |
| Pubmed identfication: |
2595451 9305847 |
| RefSeq identity: |
NM_199161 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000166147 |