Recombinant Human α-Crystallin A Chain, CRYAA (C-6His)

Contact us
Catalog number: CF01
Price: 500 €
Supplier: ab-elisa elisas
Product name: Recombinant Human α-Crystallin A Chain, CRYAA (C-6His)
Quantity: 48 wells plate
Other quantities: 1 mg 1014€ 50 µg 141€ 500 µg 659€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human alpha-Crystallin A Chain is produced by our E, coli expression system and the target gene encoding Met1-Ser173 is expressed with a 6His tag at the C-terminus
Molecular Weight: 20, 9 kD
UniProt number: P02489
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 mM EDTA, pH 8, 2 um filtered solution of phosphate buffered saline, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CRYAA (C-6His), &alpha, -Crystallin A Chain
Short name: CRYAA (C-6His), -Crystallin A Chain, Recombinant &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: alpha A (C-6His), crystallin, sapiens &alpha, -Crystallin A epitope, recombinant H
Alternative technique: rec
Alternative to gene target: CRYAA and IDBG-4699 and ENSG00000160202 and 102724652, CRYAA and IDBG-639603 and ENSBTAG00000003134 and 281718, Cryaa and IDBG-164758 and ENSMUSG00000024041 and 12954, alpha A, nuclei, this GO :0005212 and structural constituent of eye lens and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0007601 and visual perception and biological process this GO :0032387 and negative regulation of intracellular transport and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0051082 and unfolded protein binding and molecular function this GO :0051260 and protein homooli this GO merization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005212 : structural constituent of eye lens, this GO :0005212 : structural constituent of eye lens and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding and also this GO :0051082 : unfolded protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, this GO :0051082 : unfolded protein binding, unfolded protein binding, 1409, crystallin
Identity: 2388
Gene: CRYAA | More about : CRYAA
Long gene name: crystallin alpha A
Synonyms gene: CRYA1
Synonyms gene name: alpha A , crystallin
Synonyms: HSPB4
Locus: 21q22, 3
Discovery year: 1986-01-01
Entrez gene record: 1409
Classification: Small heat shock proteins
Havana BLAST/BLAT: OTTHUMG00000086842
Locus Specific Databases: LOVD - Leiden Open Variation Database

Related Products :

CF01 Recombinant Human α-Crystallin A Chain, CRYAA (C-6His) 1 mg 1014 € novo human
GENTAUR-58b8165b3fa31 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 100ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b8165b86808 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 1000ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b8165c0a1e2 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 100ug 1995 € MBS Recombinant Proteins human
GENTAUR-58b8165c5dbd1 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 1000ug 1995 € MBS Recombinant Proteins human
GENTAUR-58b83fc6a7007 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 100ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b83fc729f4a Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 1000ug 1492 € MBS Recombinant Proteins human
GENTAUR-58b83fc7863da Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 100ug 1995 € MBS Recombinant Proteins human
GENTAUR-58b83fc809e81 Anas platyrhynchos Alpha-crystallin A chain (CRYAA) 1000ug 1995 € MBS Recombinant Proteins human
GENTAUR-58bc6a64a21eb Astyanax fasciatus Alpha-crystallin A chain (cryaa) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bc6a650acf8 Astyanax fasciatus Alpha-crystallin A chain (cryaa) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bc6a6555e6b Astyanax fasciatus Alpha-crystallin A chain (cryaa) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bc6a659ef84 Astyanax fasciatus Alpha-crystallin A chain (cryaa) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba5035c7681 Balaenoptera acutorostrata Alpha-crystallin A chain (CRYAA) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba50365658a Balaenoptera acutorostrata Alpha-crystallin A chain (CRYAA) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba5036c34b5 Balaenoptera acutorostrata Alpha-crystallin A chain (CRYAA) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba50374a11c Balaenoptera acutorostrata Alpha-crystallin A chain (CRYAA) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bc1fa3e7003 Bradypus variegatus Alpha-crystallin A chain (CRYAA) 100ug 1547 € MBS Recombinant Proteins human
GENTAUR-58bc1fa43e620 Bradypus variegatus Alpha-crystallin A chain (CRYAA) 1000ug 1547 € MBS Recombinant Proteins human
GENTAUR-58bc1fa48a442 Bradypus variegatus Alpha-crystallin A chain (CRYAA) 100ug 2050 € MBS Recombinant Proteins human
GENTAUR-58bc1fa4e151c Bradypus variegatus Alpha-crystallin A chain (CRYAA) 1000ug 2050 € MBS Recombinant Proteins human
GENTAUR-58b9a8c5b4ece Camelus dromedarius Alpha-crystallin A chain (CRYAA) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58b9a8c6252e9 Camelus dromedarius Alpha-crystallin A chain (CRYAA) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58b9a8c68154c Camelus dromedarius Alpha-crystallin A chain (CRYAA) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58b9a8c6eb5ce Camelus dromedarius Alpha-crystallin A chain (CRYAA) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba23d247eaa Camelus dromedarius Alpha-crystallin A chain (CRYAA) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba23d2bfc08 Camelus dromedarius Alpha-crystallin A chain (CRYAA) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba23d3723ad Camelus dromedarius Alpha-crystallin A chain (CRYAA) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba23d40ce55 Camelus dromedarius Alpha-crystallin A chain (CRYAA) 1000ug 2056 € MBS Recombinant Proteins human
AE48869CA Cat Alpha-crystallin A chain (CRYAA) ELISA Kit 48 wells plate 500 € ab-elisa elisas cat