Recombinant Human Galectin-Related Protein, LGALSL (C-6His)

Contact us
Catalog number: CE89
Price: 1115 €
Supplier: novo
Product name: Recombinant Human Galectin-Related Protein, LGALSL (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-Related Protein is produced by our E, coli expression system and the target gene encoding Ala2-Ser172 is expressed with a 6His tag at the C-terminus
Molecular Weight: 20 kD
UniProt number: Q3ZCW2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LGALSL (C-6His), Galectin-Related Protein
Short name: LGALSL (C-6His), Recombinant Galectin- Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: LGALSL (C-6His), sapiens Galectin-Related Protein, recombinant H
Alternative technique: rec
Identity: 25012
Gene: LGALSL | More about : LGALSL
Long gene name: galectin like
Synonyms gene name: galactoside-binding-like , lectin
Synonyms: HSPC159 GRP
Synonyms name: galectin-related protein
Locus: 2p14
Discovery year: 2011-08-15
GenBank acession: AF161508
Entrez gene record: 29094
Pubmed identfication: 11042152 16682780
RefSeq identity: NM_014181
Havana BLAST/BLAT: OTTHUMG00000129541

Related Products :

CE89 Recombinant Human Galectin-Related Protein, LGALSL (C-6His) 50 µg 339 € novo human
GENTAUR-58bd68e707ab9 Xenopus tropicalis Galectin-related protein (lgalsl) 100ug 1553 € MBS Recombinant Proteins xenopus
GENTAUR-58bd68e751b0c Xenopus tropicalis Galectin-related protein (lgalsl) 1000ug 1553 € MBS Recombinant Proteins xenopus
GENTAUR-58bd68e79a5cd Xenopus tropicalis Galectin-related protein (lgalsl) 100ug 2056 € MBS Recombinant Proteins xenopus
GENTAUR-58bd68e7cc36c Xenopus tropicalis Galectin-related protein (lgalsl) 1000ug 2056 € MBS Recombinant Proteins xenopus
GWB-ATG109 LGALSL, 1-172aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
LV799413 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV799414 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV799415 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV799416 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV799418 Lgalsl Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV799417 Lgalsl Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human
abx922488 Anti-LGALSL siRNA inquire 50 € abbex human
abx922489 Anti-LGALSL siRNA 15 nmol 528 € abbex human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
C285 Recombinant Human Galectin-1, LGALS1 (C-6His) 50 µg 496 € novo human
C803 Recombinant Human Galectin-14, LGALS14 (C-6His) 10 µg 202 € novo human
C808 Recombinant Human Galectin 9 (C-6His) 50 µg 303 € novo human
CF89 Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His) 1 mg 2486 € novo human
C103 Recombinant Human Bcl-2 Related Protein A1, BCL2A1 (C-6His) 1 mg 2283 € novo human
C823 Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His) 10 µg 202 € novo human
C517 Recombinant Human Complement Factor H-Related Protein 2, CFHR2 (C-6His) 50 µg 369 € novo human
CC49 Recombinant Human Dickkopf-Related Protein 2, DKK-2 (N-Fc, C-6His) 50 µg 369 € novo human
C412 Recombinant Human Dickkopf-Related Protein 3, DKK3 (C-6His) 500 µg 1613 € novo human
CC94 Recombinant Human Follistatin-Related Protein 1, FSTL1 (C-6His) 500 µg 1613 € novo human
CF23 Recombinant Human Follistatin-Related Protein 1, FSTL1 (C-6His, E. coli) 50 µg 369 € novo e-coli
C611 Recombinant Human Glioma Pathogenesis-Related Protein 1, GLIPR1, RTVP1 (C-6His) 10 µg 202 € novo human
C389 Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12, LRP12 (C-6His) 500 µg 1613 € novo human
CI04 Recombinant Human Mammalian Ependymin-Related Protein 1, EPDR1, UCC1 (C-6His) 1 mg 1115 € novo human