Recombinant Human Galectin-14, LGALS14 (C-6His)

Contact us
Catalog number: C803
Price: 192 €
Supplier: novo
Product name: Recombinant Human Galectin-14, LGALS14 (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 17
UniProt number: Q8TCE9
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tri, 20% glycerol, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LGALS14 (C-6His), Galectin-14
Short name: LGALS14 (C-6His), Recombinant Galectin-14
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: LGALS14 (C-6His), sapiens Galectin-14, recombinant H
Alternative technique: rec
Identity: 30054
Gene: LGALS14 | More about : LGALS14
Long gene name: galectin 14
Synonyms gene name: 14 , galactoside-binding, lectin, soluble
Synonyms: PPL13 CLC2
Locus: 19q13, 2
Discovery year: 2004-05-17
GenBank acession: AF267852
Entrez gene record: 56891
Pubmed identfication: 11997112
RefSeq identity: NM_020129
Classification: Galectins
Havana BLAST/BLAT: OTTHUMG00000183143

Related Products :

C803 Recombinant Human Galectin-14, LGALS14 (C-6His) 10 µg 202 € novo human
AE35692HU-48 ELISA test for Human Placental protein 13-like (LGALS14) 1x plate of 48 wells 373 € abebio human
GENTAUR-58bd8b4e17f5f Human Placental protein 13-like (LGALS14) 100ug 1470 € MBS Recombinant Proteins human
GENTAUR-58bd8b4e8c830 Human Placental protein 13-like (LGALS14) 1000ug 1470 € MBS Recombinant Proteins human
GENTAUR-58bd8b4f0b0bb Human Placental protein 13-like (LGALS14) 100ug 1973 € MBS Recombinant Proteins human
GENTAUR-58bd8b4f8df14 Human Placental protein 13-like (LGALS14) 1000ug 1973 € MBS Recombinant Proteins human
AE35692HU-96 Human Placental protein 13-like (LGALS14) ELISA Kit 1x plate of 96 wells 612 € abebio human
GWB-BSP030 LGALS14 Human Protein bulk Ask price € genways bulk human
LV204815 LGALS14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV204816 LGALS14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV204817 LGALS14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV204818 LGALS14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV204820 LGALS14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV204819 LGALS14 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
C846 Recombinant Human Galectin-3, LGALS3 (C-6His, Human Cells) 50 µg 303 € novo human
GENTAUR-58be0cbf9e3b4 Anti- LGALS14 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0cc00a4da Anti- LGALS14 Antibody 0.12 ml 348 € MBS Polyclonals human
abx922465 Anti-LGALS14 siRNA 30 nmol 717 € abbex human
GWB-MP193D LGALS14 antibody 1 vial 521 € genways human
C285 Recombinant Human Galectin-1, LGALS1 (C-6His) 50 µg 496 € novo human
C808 Recombinant Human Galectin 9 (C-6His) 50 µg 303 € novo human
CE89 Recombinant Human Galectin-Related Protein, LGALSL (C-6His) 50 µg 339 € novo human
GWB-7C20E5 Recombinant Human Galectin-1 bulk Ask price € genways bulk human
GWB-BEA2B0 recombinant HUMAN GALECTIN-1 1 vial 614 € genways human
GWB-BIG08F Recombinant Human Galectin-1 bulk Ask price € genways bulk human
GWB-135C30 Recombinant Human Galectin-3 500 ug 662 € genways bulk human
GWB-BIG090 Recombinant Human Galectin-3 bulk Ask price € genways bulk human
GWB-E7CEE0 recombinant HUMAN GALECTIN-3 1 vial 614 € genways human
GWB-A27E9A Recombinant Human Galectin-3 His Tag bulk Ask price € genways bulk human
C068 Recombinant Human Galectin-3, LGALS3 (E. coli) 50 µg 192 € novo e-coli