| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human MAP1LC3A is produced by our E, coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 3 kD |
| UniProt number: |
Q9H492 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
0, 20% Glycerol, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MAP1LC3A (C-6His), Microtubule-Associated Protein 1 Light Chain 3 &alpha |
| Short name: |
MAP1LC3A (C-6His), Recombinant Microtubule-Associated Protein 1 Light Chain 3 &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
MAP1LC3A (C-6His), sapiens Microtubule-Associated Protein 1 Light epitope 3 &alpha, recombinant H |
| Alternative technique: |
rec |
| Identity: |
6838 |
| Gene: |
MAP1LC3A |
More about : MAP1LC3A |
| Long gene name: |
microtubule associated protein 1 light chain 3 alpha |
| Synonyms: |
MAP1BLC3 MAP1ALC3 LC3 LC3A ATG8E |
| Locus: |
20q11, 22 |
| Discovery year: |
2000-06-29 |
| Entrez gene record: |
84557 |
| Pubmed identfication: |
8833088 17580304 |
| RefSeq identity: |
NM_181509 |
| Classification: |
Autophagy related |
| Havana BLAST/BLAT: |
OTTHUMG00000032306 |